Q2WG76 · RIPP2_MOUSE
- ProteinProtein ripply2
- GeneRipply2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids128 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Plays a role in somitogenesis. Required for somite segregation and establishment of rostrocaudal polarity in somites.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Biological Process | axis specification | |
Biological Process | bone morphogenesis | |
Biological Process | determination of left/right symmetry | |
Biological Process | embryonic pattern specification | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | Notch signaling pathway | |
Biological Process | ossification | |
Biological Process | post-anal tail morphogenesis | |
Biological Process | regulation of gene expression | |
Biological Process | somite rostral/caudal axis specification | |
Biological Process | somitogenesis |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameProtein ripply2
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ2WG76
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000307760 | 1-128 | Protein ripply2 | |||
Sequence: MDTTESAESAHNPARPPSRSRCPPSAQPGSEGFWRPWVRTPGEKEKRTGPRAAEALPSGPGMAEASGKLLQYQHPVRLFWPKSKCYDYLYQEAETLLKNFPIQATISFYEDSDSEDEIEGLACENQSN |
Proteomic databases
Expression
Tissue specificity
Expressed in the embryonic anterior presomitic mesoderm. First expressed in S-I at 8.5 dpc, where expression is maintained until 13.5 dpc, with an additional stripe of expression sometimes seen in the rostral part of S0 and S-I.
Induction
By MESP2, and acts in a negative feedback loop with MESP2, functioning negatively toward MESP2 to regulate NOTCH signaling in the anterior presomitic mesoderm.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-64 | Disordered | ||||
Sequence: MDTTESAESAHNPARPPSRSRCPPSAQPGSEGFWRPWVRTPGEKEKRTGPRAAEALPSGPGMAE | ||||||
Motif | 34-37 | WRPW motif | ||||
Sequence: WRPW | ||||||
Region | 74-109 | Ripply homology domain | ||||
Sequence: HPVRLFWPKSKCYDYLYQEAETLLKNFPIQATISFY |
Domain
The ripply homology domain is required for transcriptional repression.
The WRPW motif is required for binding to tle/groucho proteins.
Sequence similarities
Belongs to the ripply family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length128
- Mass (Da)14,305
- Last updated2006-01-10 v1
- Checksum4B9FFB58B5499506
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB212223 EMBL· GenBank· DDBJ | BAE53720.1 EMBL· GenBank· DDBJ | mRNA | ||
AK081203 EMBL· GenBank· DDBJ | BAC38162.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. |