Q2VWQ2 · NELL1_MOUSE
- ProteinProtein kinase C-binding protein NELL1
- GeneNell1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids810 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a role in the control of cell growth and differentiation. Promotes osteoblast cell differentiation and terminal mineralization.
Miscellaneous
It has been demonstrated that ROBO3 binds to both NELL1 and NELL2. However, NELL1 is not expressed in the spinal cord at the time of commissural axon growth to the midline and has no significant effect on commissural axon repulsion in vitro, suggesting that NELL1 is not a functional ligand for ROBO3 in commissural axons. It remains possible, however, that NELL1 functions as a ligand for ROBO3 at another spatiotemporal location.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 434 | Ca2+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 435 | Ca2+ (UniProtKB | ChEBI) | ||||
Sequence: I | ||||||
Binding site | 437 | Ca2+ (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 453 | Ca2+ (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 454 | Ca2+ (UniProtKB | ChEBI) | ||||
Sequence: L | ||||||
Binding site | 457 | Ca2+ (UniProtKB | ChEBI) | ||||
Sequence: L |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | extracellular space | |
Cellular Component | nuclear envelope | |
Cellular Component | perinuclear region of cytoplasm | |
Molecular Function | calcium ion binding | |
Molecular Function | heparin binding | |
Molecular Function | identical protein binding | |
Molecular Function | protein kinase C binding | |
Biological Process | generation of neurons | |
Biological Process | negative regulation of osteoblast proliferation | |
Biological Process | negative regulation of protein catabolic process | |
Biological Process | positive regulation of apoptotic process | |
Biological Process | positive regulation of bone mineralization | |
Biological Process | positive regulation of ossification | |
Biological Process | positive regulation of osteoblast differentiation | |
Biological Process | regulation of gene expression | |
Biological Process | regulation of osteoblast differentiation |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameProtein kinase C-binding protein NELL1
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ2VWQ2
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Colocalizes with ATRAID on the nuclear envelope and the perinuclear region.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-21 | |||||
Sequence: MPMDVILVLWFCVCTARTVLG | ||||||
Chain | PRO_0000322642 | 22-810 | Protein kinase C-binding protein NELL1 | |||
Sequence: FGMDPDLQMDIITELDLVNTTLGVTQVAGLHNASKAFLFQDVQREIHSAPHVSEKLIQLFRNKSEFTFLATVQQKPSTSGVILSIRELEHSYFELESSGPREEIRYHYIHGGKPRTEALPYRMADGQWHKVALSVSASHLLLHVDCNRIYERVIDPPETNLPPGSNLWLGQRNQKHGFFKGIIQDGKIIFMPNGFITQCPNLNRTCPTCSDFLSLVQGIMDLQELLAKMTAKLNYAETRLGQLENCHCEKTCQVSGLLYRDQDSWVDGDNCRNCTCKSGAVECRRMSCPPLNCSPDSLPVHISGQCCKVCRPKCIYGGKVLAEGQRILTKTCRECRGGVLVKITEACPPLNCSEKDHILPENQCCRVCRGHNFCAEAPKCGENSECKNWNTKATCECKNGYISVQGNSAYCEDIDECAAKMHYCHANTVCVNLPGLYRCDCIPGYIRVDDFSCTEHDDCGSGQHNCDKNAICTNTVQGHSCTCQPGYVGNGTVCKAFCEEGCRYGGTCVAPNKCVCPSGFTGSHCEKDIDECAEGFVECHNHSRCVNLPGWYHCECRSGFHDDGTYSLSGESCIDIDECALRTHTCWNDSACINLAGGFDCLCPSGPSCSGDCPHEGGLKHNGQVWILREDRCSVCSCKDGKIFCRRTACDCQNPNVDLFCCPECDTRVTSQCLDQSGQKLYRSGDNWTHSCQQCRCLEGEADCWPLACPSLSCEYTAIFEGECCPRCVSDPCLADNIAYDIRKTCLDSSGISRLSGAVWTMAGSPCTTCQCKNGRVCCSVDLVCLENN | ||||||
Glycosylation | 40 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 53 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 83 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 224 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 294 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 372 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 395↔407 | |||||
Sequence: CAEAPKCGENSEC | ||||||
Disulfide bond | 401↔416 | |||||
Sequence: CGENSECKNWNTKATC | ||||||
Disulfide bond | 418↔432 | |||||
Sequence: CKNGYISVQGNSAYC | ||||||
Disulfide bond | 438↔451 | |||||
Sequence: CAAKMHYCHANTVC | ||||||
Disulfide bond | 445↔460 | |||||
Sequence: CHANTVCVNLPGLYRC | ||||||
Disulfide bond | 462↔474 | |||||
Sequence: CIPGYIRVDDFSC | ||||||
Disulfide bond | 480↔493 | |||||
Sequence: CGSGQHNCDKNAIC | ||||||
Disulfide bond | 487↔502 | |||||
Sequence: CDKNAICTNTVQGHSC | ||||||
Disulfide bond | 504↔515 | |||||
Sequence: CQPGYVGNGTVC | ||||||
Glycosylation | 511 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 519↔529 | |||||
Sequence: CEEGCRYGGTC | ||||||
Disulfide bond | 523↔535 | |||||
Sequence: CRYGGTCVAPNKC | ||||||
Disulfide bond | 537↔546 | |||||
Sequence: CPSGFTGSHC | ||||||
Disulfide bond | 553↔566 | |||||
Sequence: CAEGFVECHNHSRC | ||||||
Disulfide bond | 560↔575 | |||||
Sequence: CHNHSRCVNLPGWYHC | ||||||
Glycosylation | 562 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 577↔594 | |||||
Sequence: CRSGFHDDGTYSLSGESC | ||||||
Disulfide bond | 600↔613 | |||||
Sequence: CALRTHTCWNDSAC | ||||||
Disulfide bond | 607↔622 | |||||
Sequence: CWNDSACINLAGGFDC | ||||||
Glycosylation | 609 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 624↔630 | |||||
Sequence: CPSGPSC | ||||||
Glycosylation | 708 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 57-227 | Laminin G-like | ||||
Sequence: AFLFQDVQREIHSAPHVSEKLIQLFRNKSEFTFLATVQQKPSTSGVILSIRELEHSYFELESSGPREEIRYHYIHGGKPRTEALPYRMADGQWHKVALSVSASHLLLHVDCNRIYERVIDPPETNLPPGSNLWLGQRNQKHGFFKGIIQDGKIIFMPNGFITQCPNLNRTC | ||||||
Domain | 271-332 | VWFC 1 | ||||
Sequence: KTCQVSGLLYRDQDSWVDGDNCRNCTCKSGAVECRRMSCPPLNCSPDSLPVHISGQCCKVCR | ||||||
Domain | 434-475 | EGF-like 1; calcium-binding | ||||
Sequence: DIDECAAKMHYCHANTVCVNLPGLYRCDCIPGYIRVDDFSCT | ||||||
Domain | 476-516 | EGF-like 2; calcium-binding | ||||
Sequence: EHDDCGSGQHNCDKNAICTNTVQGHSCTCQPGYVGNGTVCK | ||||||
Domain | 517-547 | EGF-like 3 | ||||
Sequence: AFCEEGCRYGGTCVAPNKCVCPSGFTGSHCE | ||||||
Domain | 549-587 | EGF-like 4; calcium-binding | ||||
Sequence: DIDECAEGFVECHNHSRCVNLPGWYHCECRSGFHDDGTY | ||||||
Domain | 596-631 | EGF-like 5; calcium-binding | ||||
Sequence: DIDECALRTHTCWNDSACINLAGGFDCLCPSGPSCS | ||||||
Domain | 632-687 | VWFC 2 | ||||
Sequence: GDCPHEGGLKHNGQVWILREDRCSVCSCKDGKIFCRRTACDCQNPNVDLFCCPECD | ||||||
Domain | 692-750 | VWFC 3 | ||||
Sequence: SQCLDQSGQKLYRSGDNWTHSCQQCRCLEGEADCWPLACPSLSCEYTAIFEGECCPRCV |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length810
- Mass (Da)89,415
- Last updated2006-01-10 v1
- Checksum3AD132E97FB83590
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY622226 EMBL· GenBank· DDBJ | AAV41488.1 EMBL· GenBank· DDBJ | mRNA |