Q2V3C1 · NLTPB_ARATH
- ProteinNon-specific lipid-transfer protein 11
- GeneLTP11
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids119 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | lipid binding | |
Biological Process | lipid transport |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameNon-specific lipid-transfer protein 11
- Short namesLTP 11
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ2V3C1
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-28 | |||||
Sequence: MRNITTTTRKMLLLVITILLGIAYHGEA | ||||||
Chain | PRO_0000355618 | 29-119 | Non-specific lipid-transfer protein 11 | |||
Sequence: IACPQVNMYLAQCLPYLKAGGNPSPMCCNGLNSLKAAAPEKADRQVACNCLKSVANTIPGINDDFAKQLPAKCGVNIGVPFSKTVDCNSIN | ||||||
Disulfide bond | 31↔78 | |||||
Sequence: CPQVNMYLAQCLPYLKAGGNPSPMCCNGLNSLKAAAPEKADRQVACNC | ||||||
Disulfide bond | 41↔55 | |||||
Sequence: CLPYLKAGGNPSPMC | ||||||
Disulfide bond | 56↔101 | |||||
Sequence: CNGLNSLKAAAPEKADRQVACNCLKSVANTIPGINDDFAKQLPAKC | ||||||
Disulfide bond | 76↔115 | |||||
Sequence: CNCLKSVANTIPGINDDFAKQLPAKCGVNIGVPFSKTVDC |
Keywords
- PTM
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
Q2V3C1-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length119
- Mass (Da)12,640
- Last updated2006-01-10 v1
- Checksum4049DFDFB596B46D
Q2V3C1-2
- Name2
- Differences from canonical
- 117-119: SIN → R
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_035948 | 117-119 | in isoform 2 | |||
Sequence: SIN → R |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL035678 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL161583 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CP002687 EMBL· GenBank· DDBJ | AEE86211.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002687 EMBL· GenBank· DDBJ | AEE86212.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT011595 EMBL· GenBank· DDBJ | AAS47601.1 EMBL· GenBank· DDBJ | mRNA | ||
BT012236 EMBL· GenBank· DDBJ | AAS76723.1 EMBL· GenBank· DDBJ | mRNA | ||
BX829216 EMBL· GenBank· DDBJ | - | mRNA | No translation available. |