Q2RBD1 · Q2RBD1_ORYSJ
- ProteinNon-specific lipid-transfer protein
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids118 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
function
Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | lipid binding | |
Biological Process | lipid transport |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameNon-specific lipid-transfer protein
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ2RBD1
- Secondary accessions
Proteomes
Genome annotation databases
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-26 | |||||
Sequence: MAALNGKVVVAVMVVAMVVAAPGASA | ||||||
Chain | PRO_5013531145 | 27-118 | Non-specific lipid-transfer protein | |||
Sequence: AITCGQVGSAIAPCISYVTGRGGLTQGCCNGVKGLNNAARTTADRQAACRCLKTLAGTIKSLNLGAAAGIPGKCGVNVGFPISLSTDCSKVS |
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 30-114 | Bifunctional inhibitor/plant lipid transfer protein/seed storage helical | ||||
Sequence: CGQVGSAIAPCISYVTGRGGLTQGCCNGVKGLNNAARTTADRQAACRCLKTLAGTIKSLNLGAAAGIPGKCGVNVGFPISLSTDC |
Sequence similarities
Belongs to the plant LTP family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length118
- Mass (Da)11,440
- Last updated2006-01-24 v1
- Checksum3F6BB134B7BFEC6F
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DP000010 EMBL· GenBank· DDBJ | ABA91223.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK059714 EMBL· GenBank· DDBJ | BAG87082.1 EMBL· GenBank· DDBJ | mRNA | ||
AK061182 EMBL· GenBank· DDBJ | BAG87779.1 EMBL· GenBank· DDBJ | mRNA | ||
AK073363 EMBL· GenBank· DDBJ | BAG93418.1 EMBL· GenBank· DDBJ | mRNA | ||
AP014967 EMBL· GenBank· DDBJ | BAT12410.1 EMBL· GenBank· DDBJ | Genomic DNA |