Q2R4I5 · FLA_ORYSJ
- ProteinInactive ubiquitin-specific protease 5
- GeneUBP5
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids382 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Plays an important role in the development of floral organs and chloroplasts (PubMed:30603810).
Does not possess deubiquitinating enzyme activity in vitro (PubMed:30603810).
Does not possess deubiquitinating enzyme activity in vitro (PubMed:30603810).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane | |
Molecular Function | cysteine-type deubiquitinase activity | |
Biological Process | protein deubiquitination |
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameInactive ubiquitin-specific protease 5
- Short namesOsUBP5
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ2R4I5
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Abnormal floral organ and pollen development, and leaf bleaching.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000454381 | 1-382 | Inactive ubiquitin-specific protease 5 | |||
Sequence: MEMEMEMVVAVPSPEVPAEEERALIRDITVAAEAHAKEGDTFFLITHRWWQSWIDYVIQDLANSTNNGSHHHEHGSNVLRRPGAIDNTDLIDDTASEVSNMEIELHDTLVEGRDYILLPQQVWEKLHGWYGGGPTLPRKAINTGLSQTDLAIEVYPLRLQLLLAPKGEQAVIRISKKDTVGELHKKACEVFDLIPDEVCIWDYYGRTRHSLMDNLEKTLDDANIQMDQDILVEVTTDANGSLDGGCIGSIQENEYLERESTSLIADASKSGLSNENFASNNYTSRSYSSSLTQSQYLRSSNGDLDNMHGTSAMITRGSPLGLTGLLNLGNTCFMNSAIQCLVHTPEFARYFREDYHREINWQNPLGMVVSTLSTSMALKPYV |
Proteomic databases
Expression
Tissue specificity
Widely expressed with the highest expression in floral organs.
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 16-141 | DUSP | ||||
Sequence: VPAEEERALIRDITVAAEAHAKEGDTFFLITHRWWQSWIDYVIQDLANSTNNGSHHHEHGSNVLRRPGAIDNTDLIDDTASEVSNMEIELHDTLVEGRDYILLPQQVWEKLHGWYGGGPTLPRKAI | ||||||
Domain | 323-382 | USP | ||||
Sequence: TGLLNLGNTCFMNSAIQCLVHTPEFARYFREDYHREINWQNPLGMVVSTLSTSMALKPYV |
Sequence similarities
Belongs to the peptidase C19 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length382
- Mass (Da)42,754
- Last updated2006-07-11 v2
- Checksum29F85746746952D0
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DP000010 EMBL· GenBank· DDBJ | ABA93659.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008217 EMBL· GenBank· DDBJ | BAF28246.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014967 EMBL· GenBank· DDBJ | BAT13996.1 EMBL· GenBank· DDBJ | Genomic DNA |