Q2QZ06 · Q2QZ06_ORYSJ
- ProteinATP-dependent DNA helicase
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids665 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
Catalytic activity
- ATP + H2O = ADP + H+ + phosphate
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromosome | |
Cellular Component | cytoplasm | |
Cellular Component | mediator complex | |
Molecular Function | 3'-5' DNA helicase activity | |
Molecular Function | ATP binding | |
Molecular Function | four-way junction helicase activity | |
Molecular Function | hydrolase activity | |
Molecular Function | nucleic acid binding | |
Biological Process | DNA unwinding involved in DNA replication | |
Biological Process | double-strand break repair via homologous recombination |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameATP-dependent DNA helicase
- EC number
Gene names
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ2QZ06
Genome annotation databases
Subcellular Location
Structure
Family & Domains
Features
Showing features for domain, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-172 | Helicase ATP-binding | ||||
Sequence: MSGRDVLVIMAAGGGKSLCYQLPAVLHDGITLVVSPLLSLIQDQVMGLAALGIQAYMLASTTNKEVEKFVYKALDKGEGELKILYVTPEKISKSKRFMSKLEKCHHAGRLSLIAIDEAHCCSQWGHDFRPDYKNLGILKVQFPSVPMIALTATATNKVQIDLIEMLHIPRCV | ||||||
Domain | 197-346 | Helicase C-terminal | ||||
Sequence: VIDEIANFISESYPNNESGIVYCFSRKECEQVAKELSERGILADYYHADMDVISREKVHMRWSKSKLQVIVGTVAFGMGINKPDVRFVIHHSLSKSMETYYQESGRAGRDGLPSECILYYRPGDVPRQSSMVFYENCGLQNLYDIVRYCQ | ||||||
Coiled coil | 555-582 | |||||
Sequence: KRTKRNQMSNLEAKLDDLRRELSSSNGG | ||||||
Domain | 559-638 | HRDC | ||||
Sequence: RNQMSNLEAKLDDLRRELSSSNGGVFPHAVLSAQQISLLNRQKPTTVAELEKLIGKVKTGKYGSAIIELMLLHIDSEVAG |
Sequence similarities
Belongs to the helicase family. RecQ subfamily.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length665
- Mass (Da)74,816
- Last updated2006-07-11 v2
- Checksum775333FD2C208507
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DP000010 EMBL· GenBank· DDBJ | ABA95537.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK072117 EMBL· GenBank· DDBJ | BAG92830.1 EMBL· GenBank· DDBJ | mRNA |