Q2PE74 · IL4_BUBCA

Function

function

Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages. Stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and through the induction of RUFY4.

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentextracellular space
Molecular Functioncytokine activity
Molecular Functiongrowth factor activity
Molecular Functioninterleukin-4 receptor binding
Biological Processactivation of Janus kinase activity
Biological ProcessB cell activation
Biological ProcessB cell costimulation
Biological Processextrinsic apoptotic signaling pathway in absence of ligand
Biological Processinnate immune response in mucosa
Biological Processmicroglial cell activation
Biological Processmyeloid dendritic cell differentiation
Biological Processnegative regulation of acute inflammatory response
Biological Processnegative regulation of chronic inflammatory response
Biological Processnegative regulation of complement-dependent cytotoxicity
Biological Processnegative regulation of endothelial cell apoptotic process
Biological Processnegative regulation of epithelial cell migration
Biological Processnegative regulation of extrinsic apoptotic signaling pathway
Biological Processnegative regulation of macrophage activation
Biological Processnegative regulation of T-helper 17 cell differentiation
Biological Processpositive regulation of amyloid-beta clearance
Biological Processpositive regulation of cell population proliferation
Biological Processpositive regulation of defense response to virus by host
Biological Processpositive regulation of DNA-templated transcription
Biological Processpositive regulation of eosinophil chemotaxis
Biological Processpositive regulation of interleukin-10 production
Biological Processpositive regulation of interleukin-13 production
Biological Processpositive regulation of isotype switching to IgE isotypes
Biological Processpositive regulation of isotype switching to IgG isotypes
Biological Processpositive regulation of macroautophagy
Biological Processpositive regulation of mast cell degranulation
Biological Processpositive regulation of MHC class II biosynthetic process
Biological Processpositive regulation of mononuclear cell migration
Biological Processpositive regulation of myoblast fusion
Biological Processpositive regulation of receptor-mediated endocytosis
Biological Processpositive regulation of T cell differentiation
Biological Processpositive regulation of tyrosine phosphorylation of STAT protein
Biological ProcessT-helper 2 cell differentiation

Keywords

Names & Taxonomy

Protein names

  • Recommended name
    Interleukin-4
  • Short names
    IL-4
  • Alternative names
    • B-cell stimulatory factor 1 (BSF-1)
    • Lymphocyte stimulatory factor 1

Gene names

    • Name
      IL4

Organism names

Accessions

  • Primary accession
    Q2PE74

Subcellular Location

Keywords

PTM/Processing

Features

Showing features for signal, chain, disulfide bond, glycosylation.

TypeIDPosition(s)Description
Signal1-24
ChainPRO_000025489425-135Interleukin-4
Disulfide bond27↔135
Disulfide bond48↔85
Glycosylation62N-linked (GlcNAc...) asparagine
Disulfide bond70↔105

Keywords

PTM databases

Structure

Family & Domains

Sequence similarities

Belongs to the IL-4/IL-13 family.

Keywords

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Sequence processing
    The displayed sequence is further processed into a mature form.
  • Length
    135
  • Mass (Da)
    15,195
  • Last updated
    2006-02-07 v1
  • Checksum
    E452B7C98654271C
MGLTYQLIPVLVCLLVCTSHFVHGHKCDITLAEIIKTLNILTTRKNSCMELPVADVFAAPKNTTEKETFCRVGIELRRIYRSHTCLNKFLGGLDRNLNSLASKTCSVNEAKTSTSTLKDLLERLKTIMKEKYSKC

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
AB246275
EMBL· GenBank· DDBJ
BAE75852.1
EMBL· GenBank· DDBJ
mRNA

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp