Q2PE51 · BNP_CRODO
- ProteinBradykinin-potentiating and C-type natriuretic peptides
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids181 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Bradykinin-potentiating peptide both inhibits the activity of the angiotensin-converting enzyme (ACE) and enhances the action of bradykinin by inhibiting the peptidases that inactivate it. It acts as an indirect hypotensive agent (By similarity).
Bradykinin inhibitor peptide homolog
antagonizes the vasodilatory actions of bradykinin at the B2 bradykinin receptor (By similarity).
Has no demonstrable hypotensive activity when injected intravenously in rats
Has no demonstrable hypotensive activity when injected intravenously in rats
C-type natriuretic peptide
has a vasorelaxant activity in rat aortic strips and a diuretic potency in anesthetized rats (By similarity).
May act by activating natriuretic receptors (NPR1 and/or NPR2)
May act by activating natriuretic receptors (NPR1 and/or NPR2)
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | hormone activity | |
Molecular Function | peptidase inhibitor activity | |
Molecular Function | toxin activity | |
Biological Process | regulation of blood pressure | |
Biological Process | vasodilation |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameBradykinin-potentiating and C-type natriuretic peptides
- Alternative names
- Cleaved into 4 chains
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Lepidosauria > Squamata > Bifurcata > Unidentata > Episquamata > Toxicofera > Serpentes > Colubroidea > Viperidae > Crotalinae > Crotalus
Accessions
- Primary accessionQ2PE51
- Secondary accessions
Subcellular Location
Phenotypes & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | 31 | in isoform 2 | ||||
Sequence: Q → H | ||||||
Natural variant | 36 | in isoform 2 | ||||
Sequence: L → P |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 2 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for signal, propeptide, modified residue, peptide, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-23 | |||||
Sequence: MFVSRLAASGLLLLALLAVSLDG | ||||||
Propeptide | PRO_0000335898 | 24-30 | ||||
Sequence: KPLQQWS | ||||||
Modified residue | 31 | Pyrrolidone carboxylic acid | ||||
Sequence: Q | ||||||
Peptide | PRO_0000335899 | 31-40 | Bradykinin-potentiating peptide-1 | |||
Sequence: QRWPHLEIPP | ||||||
Propeptide | PRO_0000335900 | 41-43 | ||||
Sequence: LVV | ||||||
Modified residue | 44 | Pyrrolidone carboxylic acid | ||||
Sequence: Q | ||||||
Peptide | PRO_0000335901 | 44-49 | Bradykinin-potentiating peptide-2 | |||
Sequence: QNWKSP | ||||||
Propeptide | PRO_0000335902 | 50-78 | ||||
Sequence: TQLQARESPAGGTTALREELSLGPEAALD | ||||||
Peptide | PRO_0000335903 | 79-89 | Bradykinin inhibitor peptide homolog | |||
Sequence: TPPAGPDGGPR | ||||||
Propeptide | PRO_0000335904 | 90-157 | ||||
Sequence: GSKAAAAAPQRLSKSKGASATSAASRDLRTDGKQARQNWGRLVSPDHHSAAGGGGGGGGGARRLKGLA | ||||||
Peptide | PRO_0000335905 | 160-181 | C-type natriuretic peptide | |||
Sequence: RAGNGCFGLKLDRIGSMSGLGC | ||||||
Disulfide bond | 165↔181 | |||||
Sequence: CFGLKLDRIGSMSGLGC |
Keywords
- PTM
Expression
Tissue specificity
Venom gland.
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 74-153 | Disordered | ||||
Sequence: EAALDTPPAGPDGGPRGSKAAAAAPQRLSKSKGASATSAASRDLRTDGKQARQNWGRLVSPDHHSAAGGGGGGGGGARRL | ||||||
Compositional bias | 103-117 | Polar residues | ||||
Sequence: KSKGASATSAASRDL |
Sequence similarities
In the N-terminal section; belongs to the bradykinin-potentiating peptide family.
In the C-terminal section; belongs to the natriuretic peptide family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length181
- Mass (Da)18,514
- Last updated2006-02-07 v1
- ChecksumCF5ADC5B93747C15
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 103-117 | Polar residues | ||||
Sequence: KSKGASATSAASRDL |
Mass Spectrometry
Bradykinin inhibitor peptide homolog
Molecular mass is 1,020.5 Da. Determined by Electrospray.Keywords
- Technical term