Q2I7M2 · Q2I7M2_HORVV
- ProteinPhytochrome
- GenePhyA
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids1130 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Regulatory photoreceptor which exists in two forms that are reversibly interconvertible by light: the Pr form that absorbs maximally in the red region of the spectrum and the Pfr form that absorbs maximally in the far-red region. Photoconversion of Pr to Pfr induces an array of morphogenic responses, whereas reconversion of Pfr to Pr cancels the induction of those responses. Pfr controls the expression of a number of nuclear genes including those encoding the small subunit of ribulose-bisphosphate carboxylase, chlorophyll A/B binding protein, protochlorophyllide reductase, rRNA, etc. It also controls the expression of its own gene(s) in a negative feedback fashion.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | phosphorelay sensor kinase activity | |
Molecular Function | photoreceptor activity | |
Molecular Function | protein homodimerization activity | |
Biological Process | detection of visible light | |
Biological Process | red, far-red light phototransduction | |
Biological Process | regulation of DNA-templated transcription |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended namePhytochrome
Gene names
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Pooideae > Triticodae > Triticeae > Hordeinae > Hordeum
Accessions
- Primary accessionQ2I7M2
Genome annotation databases
PTM/Processing
Post-translational modification
Contains one covalently linked phytochromobilin chromophore.
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-26 | Polar residues | ||||
Sequence: MSSSRPATSSSSRNRQSTQERVLAQT | ||||||
Region | 1-27 | Disordered | ||||
Sequence: MSSSRPATSSSSRNRQSTQERVLAQTT | ||||||
Domain | 218-393 | Phytochrome chromophore attachment site | ||||
Sequence: SMELLCNTVVKEVFELTGYDRVMAYKFHEDNHGEVFAEITKPGLEPYLGLHYPATDIPQAARFLFMKNKVRMICDVRARTLKVIEDEALPFDISLCGSSLRAAHSCHLQYMENMNSIASLVMAVVVNESEEDDEAESEQPAQQQKKKILWGLVVCHHESPRYVPFPLRYACEFLAQ | ||||||
Domain | 619-689 | PAS | ||||
Sequence: VTSEMVRLMETATVPILAVDGNGLVNGWNQKAAELTGLRVDDAIGRHILTLVEESSVPVVQRMLYLALQGK | ||||||
Domain | 752-833 | PAS | ||||
Sequence: DYMAIVHNPNPLIPPIFGADEFGWCSEWNAAMTKLTGWHREEVLDKMLLGEVFDSSNASCLLKNKDAFVGLCVLINSALAGE | ||||||
Domain | 903-1123 | Histidine kinase | ||||
Sequence: YMRHAINNPLSGMLYSRKALKNTDLNEEQMRQIHVSDNCHHQLNKILADLDQDNIMENSSCLDLEMAEFVLQDVVVAAVSQVLIACQGKGIRISCNLPERFMKQLVYGDGIRLQQILSDFLSISVKFSPVGGSVEISAQATKNSIGENLHLIDLELRIKHRGLGVPAELMAQMFEEENTEQSEEGLGLLVSRNLLRLMNGDVRHLREAGMSIFILTAELAC |
Sequence similarities
Belongs to the phytochrome family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,130
- Mass (Da)125,261
- Last updated2006-03-07 v1
- Checksum6ED198A06014B9EB
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-26 | Polar residues | ||||
Sequence: MSSSRPATSSSSRNRQSTQERVLAQT |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DQ201141 EMBL· GenBank· DDBJ | ABB13322.1 EMBL· GenBank· DDBJ | Genomic DNA |