Q29428 · TKDP1_SHEEP
- ProteinTrophoblast Kunitz domain protein 1
- GeneTKDP1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids265 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
May play a role in mediating maternal-conceptus interactions in the immediate preimplantation period. Does not seem to have proteinase inhibitory activity.
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 218-219 | Reactive bond homolog | ||||
Sequence: NA |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Molecular Function | serine-type endopeptidase inhibitor activity |
Names & Taxonomy
Protein names
- Recommended nameTrophoblast Kunitz domain protein 1
- Short namesTKDP-1
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Artiodactyla > Ruminantia > Pecora > Bovidae > Caprinae > Ovis
Accessions
- Primary accessionQ29428
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-20 | |||||
Sequence: MRQLCLSTALLFLLVILVDS | ||||||
Chain | PRO_0000016880 | 21-265 | Trophoblast Kunitz domain protein 1 | |||
Sequence: TPLNIYHIQDEGLETSHRRGPEKRSVIDVVSGIINGVATGTKIIEKGAGILTGLAEIITKAIKGQVMISRIQFDNHTLEELPTLQLEYSTLSEENNGLKTSHRRGLEKRSVTDVVTSIINGVATGTKIIEKGAGILTGLAEIITKAIKGQVMISGIQFDNHTLEEYQTLKIEYSTLSEENKASKPALCLEPKVTGDCNATMTRYFYNTQTGLCEQFVYTGCEGNGNNFENLEDCMKTCSQEAGSL | ||||||
Glycosylation | 95 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 180 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 208↔258 | |||||
Sequence: CLEPKVTGDCNATMTRYFYNTQTGLCEQFVYTGCEGNGNNFENLEDCMKTC | ||||||
Disulfide bond | 217↔241 | |||||
Sequence: CNATMTRYFYNTQTGLCEQFVYTGC | ||||||
Glycosylation | 218 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 233↔254 | |||||
Sequence: CEQFVYTGCEGNGNNFENLEDC |
Keywords
- PTM
PTM databases
Expression
Tissue specificity
Expressed only in the trophectoderm, which forms the outer epithelial layer of the trophoblast.
Developmental stage
Maximal expression at days 14 and 16 of pregnancy.
Structure
Family & Domains
Features
Showing features for repeat, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 32-115 | 1 | ||||
Sequence: GLETSHRRGPEKRSVIDVVSGIINGVATGTKIIEKGAGILTGLAEIITKAIKGQVMISRIQFDNHTLEELPTLQLEYSTLSEEN | ||||||
Region | 32-200 | 2 X 84 AA approximate repeats | ||||
Sequence: GLETSHRRGPEKRSVIDVVSGIINGVATGTKIIEKGAGILTGLAEIITKAIKGQVMISRIQFDNHTLEELPTLQLEYSTLSEENNGLKTSHRRGLEKRSVTDVVTSIINGVATGTKIIEKGAGILTGLAEIITKAIKGQVMISGIQFDNHTLEEYQTLKIEYSTLSEEN | ||||||
Repeat | 117-200 | 2 | ||||
Sequence: GLKTSHRRGLEKRSVTDVVTSIINGVATGTKIIEKGAGILTGLAEIITKAIKGQVMISGIQFDNHTLEEYQTLKIEYSTLSEEN | ||||||
Domain | 208-258 | BPTI/Kunitz inhibitor | ||||
Sequence: CLEPKVTGDCNATMTRYFYNTQTGLCEQFVYTGCEGNGNNFENLEDCMKTC |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length265
- Mass (Da)28,964
- Last updated1996-11-01 v1
- ChecksumD700805DF03E3132
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U00165 EMBL· GenBank· DDBJ | AAA19108.1 EMBL· GenBank· DDBJ | Unassigned DNA | ||
L11343 EMBL· GenBank· DDBJ | AAB46361.1 EMBL· GenBank· DDBJ | mRNA |