Q28J82 · W11B2_XENTR
- ProteinProtein Wnt-11b-2
- Genewnt11b-2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids353 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Ligand for the frizzled7 transmembrane receptor. Primarily acts via non-canonical Wnt pathways mediated by either Ca2+ and PKC, or by JNK and dvl2/dsh. Depending on the cellular context, can also signal via the canonical Wnt pathway mediated by beta-catenin and dvl2/dsh. May also inhibit canonical Wnt signaling. Maternally initiates dorsal/ventral axis formation by a canonical route, which signals via lrp6. In a complex with wnt5a, activates the canonical and non-canonical processes involved in axis formation. In the non-canonical pathway, acts through fzd7/fz7 to induce phosphorylation of dvl2/dsh. Signals through a non-canonical Wnt pathway to regulate convergent extension movements during gastrulation. Interactions with the secreted Wnt antagonist sfrp5 to coordinate foregut development, acting via a non-canonical wnt pathway whereby sfrp5 restricts wnt11b activity to prevent inappropriate foregut formation. Mediates cardiogenesis via non-canonical Wnt signaling involving JNK-activation and PKC. Acts redundantly with wnt11/wnt11r during pronephros induction (By similarity).
Miscellaneous
Xenopus and other lower vertebrates contain duplicated wnt11 genes (wnt11 and wnt11b) resulting from an ancient gene duplication event, but the second copy has since been lost in mammals. In addition, X.tropicalis has two very similar wnt11b genes suggesting a further recent duplication event.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | signaling receptor binding | |
Biological Process | gastrulation | |
Biological Process | Wnt signaling pathway |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameProtein Wnt-11b-2
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Amphibia > Batrachia > Anura > Pipoidea > Pipidae > Xenopodinae > Xenopus > Silurana
Accessions
- Primary accessionQ28J82
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, glycosylation, disulfide bond, lipidation, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MALIRHCVTLLLILCCSRLCGA | ||||||
Chain | PRO_0000397209 | 23-353 | Protein Wnt-11b-2 | |||
Sequence: IQWLGLTVNGSRVAWNESEHCRLLDGLVPEQSQLCKRNLELMQSVVNAAKQAKLTCQMTFSDMRWNCSSVENAPNFTPDLSKGTRESAFVYALASATISHTIARACASGELPTCSCGATPAEVPGTGFRWGGCGDNLHYGLNMGSAFVDAPMKSSKSGGTQATKMINLHNNAVGRQVLMDSLETKCKCHGVSGSCSVKTCWKGLQDLPHIANELKSKYLGATKVIHRQTGTRRQLVPRELDIRPVRESELVYLVSSPDYCAKNPKLGSYGTQDRVCNKTSVGSDSCNLMCCGRGYNAYTETIVERCQCKYYWCCYVMCKKCERTVERYVCK | ||||||
Glycosylation | 31 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 38 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 78↔89 | |||||
Sequence: CQMTFSDMRWNC | ||||||
Glycosylation | 88 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 128↔136 | |||||
Sequence: CASGELPTC | ||||||
Disulfide bond | 138↔155 | |||||
Sequence: CGATPAEVPGTGFRWGGC | ||||||
Disulfide bond | 208↔222 | |||||
Sequence: CKCHGVSGSCSVKTC | ||||||
Disulfide bond | 210↔217 | |||||
Sequence: CHGVSGSC | ||||||
Lipidation | 214 | O-palmitoleoyl serine; by PORCN | ||||
Sequence: S | ||||||
Modified residue | 274 | Sulfotyrosine | ||||
Sequence: Y | ||||||
Modified residue | 281 | Sulfotyrosine | ||||
Sequence: Y | ||||||
Disulfide bond | 282↔313 | |||||
Sequence: CAKNPKLGSYGTQDRVCNKTSVGSDSCNLMCC | ||||||
Disulfide bond | 298↔308 | |||||
Sequence: CNKTSVGSDSC | ||||||
Glycosylation | 299 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 312↔352 | |||||
Sequence: CCGRGYNAYTETIVERCQCKYYWCCYVMCKKCERTVERYVC | ||||||
Disulfide bond | 328↔343 | |||||
Sequence: CQCKYYWCCYVMCKKC | ||||||
Disulfide bond | 330↔340 | |||||
Sequence: CKYYWCCYVMC | ||||||
Disulfide bond | 335↔336 | |||||
Sequence: CC |
Post-translational modification
Glycosylation is required for protein secretion.
Palmitoleoylation is required for efficient binding to frizzled receptors. Depalmitoleoylation leads to Wnt signaling pathway inhibition.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Homodimer. Secreted homodimers form a complex with wnt5a homodimers; tyrosine sulfation of both wnt11 and wnt5a by tpst1 is required for this interaction. Interacts with the transmembrane receptor fzd7/fz7. Interacts with lrp6 and ryk. Interacts with tdgf1/frl1. Interacts weakly with frzb1 and strongly with frzb2/crescent. Interaction with frzb2/crescent antagonizes wnt11 function in the neuroectoderm, but enhances it in mesodermal tissue (By similarity).
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length353
- Mass (Da)38,858
- Last updated2006-04-04 v1
- ChecksumF43C1FCAABB7166B
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CR760014 EMBL· GenBank· DDBJ | CAJ82831.1 EMBL· GenBank· DDBJ | mRNA |