Q28862 · SIAL_BOVIN
- ProteinIntegrin-binding sialoprotein
- GeneIBSP
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids310 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Promotes adhesion and migration of various cells via the alpha-V/beta-3 integrin receptor (ITGAV:ITGB3).
Miscellaneous
It is possible that the segments of clustered carboxyl groups mediate the strong binding to hydroxyapatite.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Cellular Component | vesicle | |
Biological Process | bone mineralization | |
Biological Process | cell adhesion | |
Biological Process | cellular response to growth factor stimulus | |
Biological Process | extracellular matrix organization |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameIntegrin-binding sialoprotein
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Artiodactyla > Ruminantia > Pecora > Bovidae > Bovinae > Bos
Accessions
- Primary accessionQ28862
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, modified residue, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-16 | |||||
Sequence: MKTVLILLSILGMACA | ||||||
Chain | PRO_0000020329 | 17-310 | Integrin-binding sialoprotein | |||
Sequence: LSMKNLNRRAKLEDSEENGVFKYRPQYYVYKHGYFYPALKRFAVQSSSDSSEENGNGDSSEEEEEEEETSNEEGNNGGNEDSDENEDEESEAENTTLSTTTLGYGEITPGTGDIGLAAIWLPRKAGATGKKATKEDESDEEEEEEEEEENEAEVDDNEQGINGTSSNSTEVDNGHGSSGGDNGEEDGEEESVTEANTEGITVAGETTTSPNGGFKPTTPHQEVYGTTPPPFGKITTPGEYEQTGTNEYDNGYEIYESENGDPRGDNYRAYEDEYSYYKGRGYDSYDGQDYYSHQ | ||||||
Modified residue | 31 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 62 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 67 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 75 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 76 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 98 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 106 | Phosphoserine | ||||
Sequence: S | ||||||
Glycosylation | 110 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Modified residue | 144 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 154 | Phosphoserine | ||||
Sequence: S | ||||||
Glycosylation | 178 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 183 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Modified residue | 273 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 300 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 306 | Sulfotyrosine | ||||
Sequence: Y | ||||||
Modified residue | 307 | Sulfotyrosine | ||||
Sequence: Y |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 61-284 | Disordered | ||||
Sequence: QSSSDSSEENGNGDSSEEEEEEEETSNEEGNNGGNEDSDENEDEESEAENTTLSTTTLGYGEITPGTGDIGLAAIWLPRKAGATGKKATKEDESDEEEEEEEEEENEAEVDDNEQGINGTSSNSTEVDNGHGSSGGDNGEEDGEEESVTEANTEGITVAGETTTSPNGGFKPTTPHQEVYGTTPPPFGKITTPGEYEQTGTNEYDNGYEIYESENGDPRGDNYR | ||||||
Compositional bias | 71-109 | Acidic residues | ||||
Sequence: GNGDSSEEEEEEEETSNEEGNNGGNEDSDENEDEESEAE | ||||||
Compositional bias | 153-172 | Acidic residues | ||||
Sequence: ESDEEEEEEEEEENEAEVDD | ||||||
Compositional bias | 173-192 | Polar residues | ||||
Sequence: NEQGINGTSSNSTEVDNGHG | ||||||
Compositional bias | 210-240 | Polar residues | ||||
Sequence: EANTEGITVAGETTTSPNGGFKPTTPHQEVY | ||||||
Compositional bias | 254-268 | Polar residues | ||||
Sequence: GEYEQTGTNEYDNGY | ||||||
Motif | 279-281 | Integrin-binding motif | ||||
Sequence: RGD |
Domain
The Arg-Gly-Asp (RGD) sequence serves as an integrin-binding motif and is required for integrin-mediated cell attachment.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length310
- Mass (Da)34,101
- Last updated1997-11-01 v1
- ChecksumB5BD8F61BAD88261
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0AAA9SHC6 | A0AAA9SHC6_BOVIN | IBSP | 284 | ||
A0AAA9T2J8 | A0AAA9T2J8_BOVIN | IBSP | 321 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 71-109 | Acidic residues | ||||
Sequence: GNGDSSEEEEEEEETSNEEGNNGGNEDSDENEDEESEAE | ||||||
Compositional bias | 153-172 | Acidic residues | ||||
Sequence: ESDEEEEEEEEEENEAEVDD | ||||||
Compositional bias | 173-192 | Polar residues | ||||
Sequence: NEQGINGTSSNSTEVDNGHG | ||||||
Compositional bias | 210-240 | Polar residues | ||||
Sequence: EANTEGITVAGETTTSPNGGFKPTTPHQEVY | ||||||
Compositional bias | 254-268 | Polar residues | ||||
Sequence: GEYEQTGTNEYDNGY |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
S73144 EMBL· GenBank· DDBJ | AAB30817.1 EMBL· GenBank· DDBJ | mRNA |