Q28440 · Q28440_GLOME
- ProteinSex-determining region Y protein
- GeneSry
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells. Involved in different aspects of gene regulation including promoter activation or repression. Binds to the DNA consensus sequence 5'-[AT]AACAA[AT]-3'. SRY HMG box recognizes DNA by partial intercalation in the minor groove and promotes DNA bending. Also involved in pre-mRNA splicing (By similarity).
In male adult brain involved in the maintenance of motor functions of dopaminergic neurons
In male adult brain involved in the maintenance of motor functions of dopaminergic neurons
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 1-55 | HMG box | ||||
Sequence: IVWSRDQRRKVALENPQMQNSEISKRLGYDWKMLTEAEKQPFFEEAQRLRAMHRD |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nuclear speck | |
Molecular Function | calmodulin binding | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Biological Process | anatomical structure morphogenesis | |
Biological Process | cell differentiation | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | sex differentiation |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameSex-determining region Y protein
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Artiodactyla > Whippomorpha > Cetacea > Odontoceti > Delphinidae > Globicephala
Accessions
- Primary accessionQ28440
Subcellular Location
Interaction
Subunit
Interacts with CALM, EP300, HDAC3, KPNB1, ZNF208 isoform KRAB-O, PARP1, SLC9A3R2 and WT1. The interaction with EP300 modulates its DNA-binding activity. The interaction with KPNB1 is sensitive to dissociation by Ran in the GTP-bound form. Interaction with PARP1 impaired its DNA-binding activity.
Structure
Sequence
- Sequence statusFragment
- Length55
- Mass (Da)6,749
- Last updated1996-11-01 v1
- ChecksumB0F44122D4091EB8
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: I | ||||||
Non-terminal residue | 55 | |||||
Sequence: D |