Q28142 · NRX1B_BOVIN
- ProteinNeurexin-1-beta
- GeneNRXN1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids467 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell projection | |
Cellular Component | plasma membrane | |
Cellular Component | presynaptic membrane | |
Molecular Function | metal ion binding | |
Biological Process | angiogenesis | |
Biological Process | cell adhesion |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameNeurexin-1-beta
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Artiodactyla > Ruminantia > Pecora > Bovidae > Bovinae > Bos
Accessions
- Primary accessionQ28142
Proteomes
Subcellular Location
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 46-391 | Extracellular | ||||
Sequence: ASSLGAHHIHHFHGSSKHHSVPIAIYRSPASLRGGHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSEMSTSIMETTTTLATSTARRGNSPTKEPVSQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRAGGREPYPGSAEVIRESSSTT | ||||||
Transmembrane | 392-412 | Helical | ||||
Sequence: GMVVGIVAAAALCILILLYAM | ||||||
Topological domain | 413-467 | Cytoplasmic | ||||
Sequence: YKYRNRDEGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSANKNKKNKDKEYYV |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, glycosylation, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-45 | |||||
Sequence: MYQRMLRCGAELGSPGGGGGGAGGRLALLWIVPLTLSGLLGVAWG | ||||||
Chain | PRO_0000019492 | 46-467 | Neurexin-1-beta | |||
Sequence: ASSLGAHHIHHFHGSSKHHSVPIAIYRSPASLRGGHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSEMSTSIMETTTTLATSTARRGNSPTKEPVSQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRAGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSANKNKKNKDKEYYV | ||||||
Glycosylation | 183 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 345 | O-linked (Xyl...) (heparan sulfate) serine | ||||
Sequence: S | ||||||
Modified residue | 449 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 450 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 453 | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Interacts with CBLN2 and more weakly with CBLN4 (By similarity).
Interacts with CBLN1; interaction is CBLN1 hexamer form-dependent; CBLN1-binding is calcium-independent; isoform 1b does not interact with CBLN1 (By similarity).
Interacts with CLSTN3 (By similarity).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 86-284 | Laminin G-like | ||||
Sequence: YIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNV | ||||||
Region | 200-229 | Essential for interaction with CBLN1; modulates interaction affinity with NLGN1, NLGN2 and NLGN3; prevents interaction with DAG1/alpha-dystroglycan; modulates interaction with alpha-latrotoxin | ||||
Sequence: GNNDNERLAIARQRIPYRLGRVVDEWLLDK | ||||||
Compositional bias | 318-343 | Polar residues | ||||
Sequence: LATSTARRGNSPTKEPVSQTTDDILV | ||||||
Region | 318-380 | Disordered | ||||
Sequence: LATSTARRGNSPTKEPVSQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRAGGREPYPGS | ||||||
Compositional bias | 434-450 | Polar residues | ||||
Sequence: NSAQSNGAVVKEKQPSS | ||||||
Region | 434-467 | Disordered | ||||
Sequence: NSAQSNGAVVKEKQPSSAKSANKNKKNKDKEYYV | ||||||
Compositional bias | 451-467 | Basic and acidic residues | ||||
Sequence: AKSANKNKKNKDKEYYV |
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 16 isoforms produced by Alternative promoter usage & Alternative splicing. A number of isoforms alpha-type and beta-type are produced by alternative promoter usage. Beta-type isoforms differ from alpha-type isoforms in their N-terminus. In addition, there are at least five alternatively spliced sites, each of which may be spliced in up to seven different ways. Combinatorial splicing at each of these sites may lead to the generation of at least 96 isoforms. Experimental confirmation may be lacking for some isoforms.
Q28142-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1b
- SynonymsBeta-4A5A
- Length467
- Mass (Da)50,084
- Last updated2001-11-16 v2
- Checksum70D281E2510AB21E
Q28142-2
- Name2b
- SynonymsBeta-4A5B
- Differences from canonical
- 363-365: Missing
Q28142-3
- Name3b
- SynonymsBeta-4B5A
- Differences from canonical
- 201-230: Missing
Q28142-4
- Name4b
- SynonymsBeta-4B5B
Q28146-1
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- Name1a
- SynonymsAlpha-1A2A3A4A5A
Q28146-2
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- Name2a
- SynonymsAlpha-1B
Q28146-3
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- Name3a
- SynonymsAlpha-1C
Q28146-4
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- Name4a
- SynonymsAlpha-1D
Q28146-5
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- Name5a
- SynonymsAlpha-1E
Q28146-6
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- Name6a
- SynonymsAlpha-1F
Q28146-7
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- Name7a
- SynonymsAlpha-1G
Q28146-8
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- Name8a
- SynonymsAlpha-2B
Q28146-9
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- Name9a
- SynonymsAlpha-2C
Q28146-10
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- Name10a
- SynonymsAlpha-3B
Q28146-11
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- Name11a
- SynonymsAlpha-4B
Q28146-12
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- Name12a
- SynonymsAlpha-5B
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_003494 | 201-230 | in isoform 3b and isoform 4b | |||
Sequence: Missing | ||||||
Compositional bias | 318-343 | Polar residues | ||||
Sequence: LATSTARRGNSPTKEPVSQTTDDILV | ||||||
Alternative sequence | VSP_003495 | 363-365 | in isoform 2b and isoform 4b | |||
Sequence: Missing | ||||||
Compositional bias | 434-450 | Polar residues | ||||
Sequence: NSAQSNGAVVKEKQPSS | ||||||
Compositional bias | 451-467 | Basic and acidic residues | ||||
Sequence: AKSANKNKKNKDKEYYV |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L27870 EMBL· GenBank· DDBJ | AAA19906.1 EMBL· GenBank· DDBJ | mRNA |