Q24MZ3 · Q24MZ3_DESHY
- ProteinGlycerol kinase
- GeneglpK
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids528 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Key enzyme in the regulation of glycerol uptake and metabolism. Catalyzes the phosphorylation of glycerol to yield sn-glycerol 3-phosphate.
Catalytic activity
- ATP + glycerol = ADP + H+ + sn-glycerol 3-phosphate
Activity regulation
Activated by phosphorylation and inhibited by fructose 1,6-bisphosphate (FBP).
Pathway
Polyol metabolism; glycerol degradation via glycerol kinase pathway; sn-glycerol 3-phosphate from glycerol: step 1/1.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 46 | ADP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 46 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 46 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 47 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 48 | ATP (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 50 | ADP (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 116 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 116 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 117 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 117 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 168 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 168 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 278 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 278 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 279 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 300 | ADP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 300 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 343 | ADP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 343 | ATP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 347 | ATP (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 444 | ADP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 444 | ATP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 448 | ADP (UniProtKB | ChEBI) | ||||
Sequence: N |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | ATP binding | |
Molecular Function | glycerol kinase activity | |
Biological Process | glycerol catabolic process | |
Biological Process | glycerol-3-phosphate metabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGlycerol kinase
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Bacillota > Clostridia > Eubacteriales > Desulfitobacteriaceae > Desulfitobacterium
Accessions
- Primary accessionQ24MZ3
Proteomes
Interaction
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 38-285 | Carbohydrate kinase FGGY N-terminal | ||||
Sequence: YVLALDQGTTSCRAILFDRESQIVGVAQKEFTQIYPQPGWVEHDPEEVWSTQYGVIAELLARYQVTSEEIAGIGITNQRETTVVWDKHTGKSVTNAIVWQCRRTAPLCDELKMKGLEPLFKEKTGLVLDAYFSGTKIRWILDRVPGAQEKAEKGELLFGTMDTWLVWNLTKGRIHVTDYSNASRTLLYNIKTLAWDPDLLQVLNIPLAMLPEVKPSSTIYGETAAEGLFGHPIPIAGIAGDQQAALFG | ||||||
Domain | 295-483 | Carbohydrate kinase FGGY C-terminal | ||||
Sequence: KNTYGTGCFMLLNTGEELYESRHGLISTIAWGLDEKVIYALEGSVFMAGAVMQWLRDELKLIETAGDSEYFAGKVADNGGVYLVPAFTGLGAPYWDMDARGAIVGLTRGSNKNHIIRAALESMAYQTRDILEAMEADSQLPLQLLKVDGGAVVNNLLMQFQADILGVEVERPHCIETTALGAAYLAGLA |
Sequence similarities
Belongs to the FGGY kinase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length528
- Mass (Da)58,585
- Last updated2006-04-18 v1
- Checksum862E5C73E9A8955E
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP008230 EMBL· GenBank· DDBJ | BAE86599.1 EMBL· GenBank· DDBJ | Genomic DNA |