Q24522 · BUN1_DROME
- ProteinProtein bunched, class 1/class 3/D/E isoforms
- Genebun
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids219 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | nucleus | |
Molecular Function | protein homodimerization activity | |
Biological Process | chorion-containing eggshell formation | |
Biological Process | compound eye photoreceptor cell differentiation | |
Biological Process | determination of adult lifespan | |
Biological Process | dorsal appendage formation | |
Biological Process | follicle cell of egg chamber migration | |
Biological Process | intestinal stem cell homeostasis | |
Biological Process | mushroom body development | |
Biological Process | negative regulation of apoptotic process | |
Biological Process | negative regulation of cell fate specification | |
Biological Process | positive regulation of cell growth | |
Biological Process | positive regulation of cell population proliferation | |
Biological Process | positive regulation of neuroblast proliferation | |
Biological Process | regulation of transcription by RNA polymerase II | |
Biological Process | tissue regeneration |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameProtein bunched, class 1/class 3/D/E isoforms
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ24522
- Secondary accessions
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000219376 | 1-219 | Protein bunched, class 1/class 3/D/E isoforms | |||
Sequence: MKTETGSNNNNTTVVNMDFDMYPSISGKQQDPVREVVMKYIDYFLPDASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAPAVQSVVAPAAAGQAVQQQAAGAVAVTGVATSPASAVVPTSIPNGSAENGSSAVESAAVSVEQQVQQVTSAAAAAASVVTANGPMS |
Expression
Tissue specificity
Gene expression databases
Structure
Family & Domains
Sequence & Isoforms
- Sequence statusComplete
This entry describes 7 isoforms produced by Alternative splicing.
Q24522-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameClass 1
- SynonymsB
- Length219
- Mass (Da)22,742
- Last updated2004-05-10 v2
- Checksum29B3C20698C38743
Q24522-2
- NameClass 3
- SynonymsC
- Differences from canonical
- 1-64: MKTETGSNNNNTTVVNMDFDMYPSISGKQQDPVREVVMKYIDYFLPDASGTSAVAIDNKIEQAM → MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAK
Q24522-3
- NameD
- SynonymsH
- Differences from canonical
- 2-47: KTETGSNNNNTTVVNMDFDMYPSISGKQQDPVREVVMKYIDYFLPD → IKYPRTTSSTSSGYFDDDEAMMNPYQTPPASPQSVPQYLQRHMVRMFSTEVDN
Q24522-4
- NameE
- Differences from canonical
- 1-47: MKTETGSNNNNTTVVNMDFDMYPSISGKQQDPVREVVMKYIDYFLPD → MAALANKMAANMATTSSSSNNNNIAGSESTLQQQQMLHHQQQQQQQTQSNLIMPAAVIQPEYLLNNDRGLFKVYCFIKDFIG
Q24523-1
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- NameClass 2
- SynonymsA
Q24523-3
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- NameF
Q24523-4
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- NameG
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_035859 | 1-47 | in isoform E | |||
Sequence: MKTETGSNNNNTTVVNMDFDMYPSISGKQQDPVREVVMKYIDYFLPD → MAALANKMAANMATTSSSSNNNNIAGSESTLQQQQMLHHQQQQQQQTQSNLIMPAAVIQPEYLLNNDRGLFKVYCFIKDFIG | ||||||
Alternative sequence | VSP_010282 | 1-64 | in isoform Class 3 | |||
Sequence: MKTETGSNNNNTTVVNMDFDMYPSISGKQQDPVREVVMKYIDYFLPDASGTSAVAIDNKIEQAM → MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAK | ||||||
Alternative sequence | VSP_035860 | 2-47 | in isoform D | |||
Sequence: KTETGSNNNNTTVVNMDFDMYPSISGKQQDPVREVVMKYIDYFLPD → IKYPRTTSSTSSGYFDDDEAMMNPYQTPPASPQSVPQYLQRHMVRMFSTEVDN | ||||||
Sequence conflict | 30 | in Ref. 2; AAB61239 | ||||
Sequence: Q → E | ||||||
Sequence conflict | 34 | in Ref. 2; AAB61239 | ||||
Sequence: R → C | ||||||
Sequence conflict | 100 | in Ref. 2; AAB61239 | ||||
Sequence: N → H | ||||||
Sequence conflict | 106 | in Ref. 2; AAB61239 | ||||
Sequence: N → K | ||||||
Sequence conflict | 122-123 | in Ref. 2; AAB61239 | ||||
Sequence: AA → PR | ||||||
Sequence conflict | 188 | in Ref. 2; AAB61239 | ||||
Sequence: E → G | ||||||
Sequence conflict | 192 | in Ref. 2; AAB61239 | ||||
Sequence: V → G | ||||||
Sequence conflict | 202-203 | in Ref. 1; AAC41607 and 2; AAB61239 | ||||
Sequence: TS → QQVTSAA |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L42511 EMBL· GenBank· DDBJ | AAC41607.1 EMBL· GenBank· DDBJ | mRNA | ||
AF003342 EMBL· GenBank· DDBJ | AAB61239.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AE014134 EMBL· GenBank· DDBJ | AAF53200.3 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014134 EMBL· GenBank· DDBJ | AAN10817.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014134 EMBL· GenBank· DDBJ | ABI31312.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014134 EMBL· GenBank· DDBJ | ACZ94250.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014134 EMBL· GenBank· DDBJ | ACZ94251.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY060295 EMBL· GenBank· DDBJ | AAL25334.1 EMBL· GenBank· DDBJ | mRNA |