Q24432 · OMB_DROME
- ProteinOptomotor-blind protein
- Genebi
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids972 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Essential protein that may function as a transcription regulator. Vital for pupal development. Required for proper development of the optic lobes and wings, and abdominal pigmentation.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 332-513 | T-box | ||||
Sequence: LEGKDLWEKFHKLGTEMVITKSGRQMFPQMKFRVSGLDAKAKYILLLDIVAADDYRYKFHNSRWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKVVSFHKLKLTNNISDKHGFVSTTILNSMHKYQPRFHLVRANDILKLPYSTFRTYVFKETEFIAVTAYQNEKITQLKIDNNPFAKGFRD |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromatin | |
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Biological Process | cell fate specification | |
Biological Process | compound eye morphogenesis | |
Biological Process | developmental pigmentation | |
Biological Process | imaginal disc-derived wing morphogenesis | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | organ growth | |
Biological Process | positive regulation of DNA-templated transcription | |
Biological Process | regulation of transcription by RNA polymerase II | |
Biological Process | wing disc anterior/posterior pattern formation | |
Biological Process | wing disc morphogenesis |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameOptomotor-blind protein
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ24432
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000184466 | 1-972 | Optomotor-blind protein | |||
Sequence: MRYDVQELLLHQSAEDPFARFANGMAYHPFLQLTQRPTDFSVSSLLTAGSNNNNSGNTNSGNNNSNSNNNTNSNTNNTNNLVAVSPTGGGAQLSPQSNHSSSNTTTTSNTNNSSSNNNNNNSTHNNNNNHTNNNNNNNNNTSQKQGHHLSTTEEPPSPAGTPPPTIVGLPPIPPPNNNSSSSSSNNSASAAAHPSHHPTAAHHSPSTGAAAPPAGPTGLPPPTPPHHLQQQQQQQQHPAPPPPPYFPAAALAALAGSPAGPHPGLYPGGGLRFPPHHPGAHPHAHHLGSAYTTAEDVVLASAVAHQLHPAMRPLRALQPEDDGVVDDPKVTLEGKDLWEKFHKLGTEMVITKSGRQMFPQMKFRVSGLDAKAKYILLLDIVAADDYRYKFHNSRWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKVVSFHKLKLTNNISDKHGFVSTTILNSMHKYQPRFHLVRANDILKLPYSTFRTYVFKETEFIAVTAYQNEKITQLKIDNNPFAKGFRDTGAGKREKKQALMSNRGSDSDKLNPTHVSSSRAPLHLGHAGRPPHLHPHAALLDNQQDDDDKLLDVVGPPQSPLLPLSHSLQQMHAHQHSAALAAWFNHLAGAGAGASEHAAAAAANASAEDALRRRLQADADVERDGSDSSCSESVGGSTGGAFRPTSTGSPKEAVGAAAAAAAAGLNPGGGSYPSPNISVGPPIHPSPHLLPYLYPHGLYPPPHLGLLHNPAAAAAMSPAGLNPGLLFNAQLALAAQHPALFGHAYAAAGHTPVSPLQGLKSHRFSPYSLPGSLGSAFDAVTPGSNANRSGDPPGGGGGGLGGGVVENGPRSLSSSPRPRPASHSPPTRPISMSPTTPPSLMKQPRGGGAGAGVAQSQHSPSELKSMEKMVNGLEVQHNGSAAAAAAALQLAEEAAQHHHHTQAHHQQQQHQSHHQQQHHQQPAQPHPHHQTHLHSHHGATTGGTDQ | ||||||
Modified residue | 887 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
In third-instar larvae, expressed in the brain region that will develop into optic lobes and more weakly in the thoracic part of the ventral ganglion.
Developmental stage
The peak periods of expression are: mid-embryogenesis, the second day of pupal development and in the adult.
Gene expression databases
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 44-155 | Polar residues | ||||
Sequence: SLLTAGSNNNNSGNTNSGNNNSNSNNNTNSNTNNTNNLVAVSPTGGGAQLSPQSNHSSSNTTTTSNTNNSSSNNNNNNSTHNNNNNHTNNNNNNNNNTSQKQGHHLSTTEEP | ||||||
Region | 44-248 | Disordered | ||||
Sequence: SLLTAGSNNNNSGNTNSGNNNSNSNNNTNSNTNNTNNLVAVSPTGGGAQLSPQSNHSSSNTTTTSNTNNSSSNNNNNNSTHNNNNNHTNNNNNNNNNTSQKQGHHLSTTEEPPSPAGTPPPTIVGLPPIPPPNNNSSSSSSNNSASAAAHPSHHPTAAHHSPSTGAAAPPAGPTGLPPPTPPHHLQQQQQQQQHPAPPPPPYFPA | ||||||
Compositional bias | 156-177 | Pro residues | ||||
Sequence: PSPAGTPPPTIVGLPPIPPPNN | ||||||
Compositional bias | 178-193 | Polar residues | ||||
Sequence: NSSSSSSNNSASAAAH | ||||||
Region | 263-286 | Disordered | ||||
Sequence: PGLYPGGGLRFPPHHPGAHPHAHH | ||||||
Region | 508-563 | Disordered | ||||
Sequence: AKGFRDTGAGKREKKQALMSNRGSDSDKLNPTHVSSSRAPLHLGHAGRPPHLHPHA | ||||||
Compositional bias | 513-528 | Basic and acidic residues | ||||
Sequence: DTGAGKREKKQALMSN | ||||||
Compositional bias | 529-544 | Polar residues | ||||
Sequence: RGSDSDKLNPTHVSSS | ||||||
Region | 645-676 | Disordered | ||||
Sequence: ADVERDGSDSSCSESVGGSTGGAFRPTSTGSP | ||||||
Compositional bias | 654-671 | Polar residues | ||||
Sequence: SSCSESVGGSTGGAFRPT | ||||||
Region | 805-889 | Disordered | ||||
Sequence: AVTPGSNANRSGDPPGGGGGGLGGGVVENGPRSLSSSPRPRPASHSPPTRPISMSPTTPPSLMKQPRGGGAGAGVAQSQHSPSEL | ||||||
Compositional bias | 845-859 | Pro residues | ||||
Sequence: RPASHSPPTRPISMS | ||||||
Region | 918-972 | Disordered | ||||
Sequence: EEAAQHHHHTQAHHQQQQHQSHHQQQHHQQPAQPHPHHQTHLHSHHGATTGGTDQ | ||||||
Compositional bias | 934-954 | Polar residues | ||||
Sequence: QQHQSHHQQQHHQQPAQPHPH |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length972
- Mass (Da)102,557
- Last updated2003-02-28 v3
- Checksum61D2B3576DC6B853
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 10 | in Ref. 2; AAF45946 | ||||
Sequence: L → F | ||||||
Compositional bias | 44-155 | Polar residues | ||||
Sequence: SLLTAGSNNNNSGNTNSGNNNSNSNNNTNSNTNNTNNLVAVSPTGGGAQLSPQSNHSSSNTTTTSNTNNSSSNNNNNNSTHNNNNNHTNNNNNNNNNTSQKQGHHLSTTEEP | ||||||
Compositional bias | 156-177 | Pro residues | ||||
Sequence: PSPAGTPPPTIVGLPPIPPPNN | ||||||
Compositional bias | 178-193 | Polar residues | ||||
Sequence: NSSSSSSNNSASAAAH | ||||||
Sequence conflict | 216 | in Ref. 2; AAF45946 | ||||
Sequence: P → A | ||||||
Sequence conflict | 511 | in Ref. 1; AAA28736 | ||||
Sequence: F → L | ||||||
Compositional bias | 513-528 | Basic and acidic residues | ||||
Sequence: DTGAGKREKKQALMSN | ||||||
Sequence conflict | 522 | in Ref. 1; AAA28736 | ||||
Sequence: K → NCYR | ||||||
Compositional bias | 529-544 | Polar residues | ||||
Sequence: RGSDSDKLNPTHVSSS | ||||||
Compositional bias | 654-671 | Polar residues | ||||
Sequence: SSCSESVGGSTGGAFRPT | ||||||
Sequence conflict | 820 | in Ref. 1; AAA28736 | ||||
Sequence: Missing | ||||||
Compositional bias | 845-859 | Pro residues | ||||
Sequence: RPASHSPPTRPISMS | ||||||
Compositional bias | 934-954 | Polar residues | ||||
Sequence: QQHQSHHQQQHHQQPAQPHPH |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M81796 EMBL· GenBank· DDBJ | AAA28736.1 EMBL· GenBank· DDBJ | mRNA | ||
AE014298 EMBL· GenBank· DDBJ | AAF45946.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
S61732 EMBL· GenBank· DDBJ | AAB26697.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S61727 EMBL· GenBank· DDBJ | AAB26697.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S61729 EMBL· GenBank· DDBJ | AAB26697.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S61744 EMBL· GenBank· DDBJ | AAB26699.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S61743 EMBL· GenBank· DDBJ | AAB26699.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S61955 EMBL· GenBank· DDBJ | AAB26699.1 EMBL· GenBank· DDBJ | Genomic DNA |