Q24120 · CAPU_DROME
- ProteinProtein cappuccino
- Genecapu
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1059 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Acts as an actin nucleation factor and promotes assembly of actin filaments together with spir. May play a role in intracellular vesicle transport along actin fibers, providing a novel link between actin cytoskeleton dynamics and intracellular transport.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | actin filament | |
Cellular Component | cell cortex | |
Cellular Component | cytoplasm | |
Cellular Component | cytoplasmic vesicle membrane | |
Cellular Component | cytosol | |
Molecular Function | actin binding | |
Molecular Function | microtubule binding | |
Biological Process | actin filament organization | |
Biological Process | actin filament-based process | |
Biological Process | actin nucleation | |
Biological Process | chorion-containing eggshell formation | |
Biological Process | oogenesis | |
Biological Process | pole plasm assembly | |
Biological Process | pole plasm oskar mRNA localization | |
Biological Process | pole plasm RNA localization | |
Biological Process | protein transport |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameProtein cappuccino
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ24120
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Peripheral membrane protein
Cytoplasmic vesicle membrane ; Peripheral membrane protein
Note: Recruited to membranes via its interaction with spir.
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 1049 | Abolishes interaction with spir. | ||||
Sequence: K → A or D | ||||||
Mutagenesis | 1051 | Abolishes interaction with spir. | ||||
Sequence: R → A or D | ||||||
Mutagenesis | 1055 | Abolishes interaction with spir. | ||||
Sequence: R → A or D |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000194884 | 1-1059 | Protein cappuccino | |||
Sequence: MALQLGKKLAQVLGSGAGSPLTPGTMEPCAAGSGSPLANGELFNVSKAKKVELQNLSSRFTAAVTQTPPGVTSSTPNESGVTGPAGPLGATTSSPSLETQSTVIISFKSSQTPVQSQTNSAASENVEDDTAPLPLPPPPPGFGTPTTPLLSSNVLKKVASFTVEKSSAGNNSSNPPNLCPTSDETTLLATPCSSSLTVATLPPEIAVGAAAGGVAGGAGSRRGSSYVPEKLSFAAYEKFEGQMLIKWLISTMQSNPKSSSGDANQELFNTLALQFCNNLKYVGVLKQISNEHLDCGFSPYEMYQWTHTEQPTTSLPLTPGKLDKVAAWPFSSTPSGIRALESASLASLGAGGVAGSLATIATASTASSDNQKTLQQILKKRLLNCTTLAEVHAVVNELLSSVDEPPRRPSKRCVNLTELLNASEATVYEYNKTGAEGCVKSFTDAETQTESEDCEGTCKCGQSSTKVSDNESAKEDGEKPHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPAPLPDPAEGNWFHRTNTMRKSAVNPPKPMRPLYWTRIVTSAPPAPRPPSVANSTDSTENSGSSPDEPPAANGADAPPTAPPATKEIWTEIEETPLDNIDEFTELFSRQAIAPVSKPKELKVKRAKSIKVLDPERSRNVGIIWRSLHVPSSEIEHAIYHIDTSVVSLEALQHMSNIQATEDELQRIKEAAGGDIPLDHPEQFLLDISLISMASERISCIVFQAEFEESVTLLFRKLETVSQLSQQLIESEDLKLVFSIILTLGNYMNGGNRQRGQADGFNLDILGKLKDVKSKESHTTLLHFIVRTYIAQRRKEGVHPLEIRLPIPEPADVERAAQMDFEEVQQQIFDLNKKFLGCKRTTAKVLAASRPEIMEPFKSKMEEFVEGADKSMAKLHQSLDECRDLFLETMRFYHFSPKACTLTLAQCTPDQFFEYWTNFTNDFKDIWKKEITSLLNELMKKSKQAQIESRRNVSTKVEKSGRISLKERMLMRRSKN |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 62-126 | Polar residues | ||||
Sequence: AAVTQTPPGVTSSTPNESGVTGPAGPLGATTSSPSLETQSTVIISFKSSQTPVQSQTNSAASENV | ||||||
Region | 62-146 | Disordered | ||||
Sequence: AAVTQTPPGVTSSTPNESGVTGPAGPLGATTSSPSLETQSTVIISFKSSQTPVQSQTNSAASENVEDDTAPLPLPPPPPGFGTPT | ||||||
Compositional bias | 131-145 | Pro residues | ||||
Sequence: APLPLPPPPPGFGTP | ||||||
Region | 448-647 | Disordered | ||||
Sequence: QTESEDCEGTCKCGQSSTKVSDNESAKEDGEKPHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPAPLPDPAEGNWFHRTNTMRKSAVNPPKPMRPLYWTRIVTSAPPAPRPPSVANSTDSTENSGSSPDEPPAANGADAPPTAPP | ||||||
Compositional bias | 454-468 | Polar residues | ||||
Sequence: CEGTCKCGQSSTKVS | ||||||
Domain | 480-560 | FH1 | ||||
Sequence: PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPS | ||||||
Compositional bias | 482-559 | Pro residues | ||||
Sequence: AVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP | ||||||
Domain | 585-1032 | FH2 | ||||
Sequence: RKSAVNPPKPMRPLYWTRIVTSAPPAPRPPSVANSTDSTENSGSSPDEPPAANGADAPPTAPPATKEIWTEIEETPLDNIDEFTELFSRQAIAPVSKPKELKVKRAKSIKVLDPERSRNVGIIWRSLHVPSSEIEHAIYHIDTSVVSLEALQHMSNIQATEDELQRIKEAAGGDIPLDHPEQFLLDISLISMASERISCIVFQAEFEESVTLLFRKLETVSQLSQQLIESEDLKLVFSIILTLGNYMNGGNRQRGQADGFNLDILGKLKDVKSKESHTTLLHFIVRTYIAQRRKEGVHPLEIRLPIPEPADVERAAQMDFEEVQQQIFDLNKKFLGCKRTTAKVLAASRPEIMEPFKSKMEEFVEGADKSMAKLHQSLDECRDLFLETMRFYHFSPKACTLTLAQCTPDQFFEYWTNFTNDFKDIWKKEITSLLNELMKKSKQAQIES | ||||||
Compositional bias | 616-632 | Polar residues | ||||
Sequence: VANSTDSTENSGSSPDE | ||||||
Region | 1049-1059 | Important for interaction with spir | ||||
Sequence: KERMLMRRSKN |
Sequence similarities
Belongs to the formin homology family. Cappuccino subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,059
- Mass (Da)113,864
- Last updated2001-02-21 v2
- Checksum009B0E24F61B6EA5
Computationally mapped potential isoform sequences
There are 8 potential isoforms mapped to this entry
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 62-126 | Polar residues | ||||
Sequence: AAVTQTPPGVTSSTPNESGVTGPAGPLGATTSSPSLETQSTVIISFKSSQTPVQSQTNSAASENV | ||||||
Compositional bias | 131-145 | Pro residues | ||||
Sequence: APLPLPPPPPGFGTP | ||||||
Sequence conflict | 260 | in Ref. 1; AAC46925 | ||||
Sequence: S → C | ||||||
Sequence conflict | 364 | in Ref. 1; AAC46925 | ||||
Sequence: S → T | ||||||
Sequence conflict | 386 | in Ref. 1; AAC46925 | ||||
Sequence: T → S | ||||||
Compositional bias | 454-468 | Polar residues | ||||
Sequence: CEGTCKCGQSSTKVS | ||||||
Sequence conflict | 471 | in Ref. 1; AAC46925 | ||||
Sequence: E → K | ||||||
Compositional bias | 482-559 | Pro residues | ||||
Sequence: AVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP | ||||||
Sequence conflict | 495 | in Ref. 1; AAC46925 | ||||
Sequence: H → P | ||||||
Sequence conflict | 513 | in Ref. 1; AAC46925 | ||||
Sequence: Missing | ||||||
Compositional bias | 616-632 | Polar residues | ||||
Sequence: VANSTDSTENSGSSPDE |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U34258 EMBL· GenBank· DDBJ | AAC46925.1 EMBL· GenBank· DDBJ | mRNA | ||
AE014134 EMBL· GenBank· DDBJ | AAF51054.1 EMBL· GenBank· DDBJ | Genomic DNA |