Q24009 · BICC_DROME
- ProteinProtein bicaudal C
- GeneBicC
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids905 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
RNA-binding protein that is involved in oogenesis. Required for correct targeting of the migrating anterior follicle cells and the establishment of anterior-posterior polarity in the oocyte. May act as translational repressor of oskar during oogenesis. Function seems to be sensitive to small changes in expression.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | mRNA binding | |
Biological Process | actin cytoskeleton organization | |
Biological Process | follicle cell of egg chamber migration | |
Biological Process | microtubule cytoskeleton organization | |
Biological Process | mitotic cell cycle | |
Biological Process | negative regulation of oskar mRNA translation | |
Biological Process | oogenesis |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein bicaudal C
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ24009
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 296 | In allele RU-35; bicaudal phenotype; lowers RNA-binding. | ||||
Sequence: G → R |
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000267718 | 1-905 | Protein bicaudal C | |||
Sequence: MLSCASFNKLMYPSAADVAKPPMVGLEVEAGSIGSLSSLHALPSTTSVGSGAPSETQSEISSVDSDWSDIRAIAMKLGVQNPDDLHTERFKVDRQKLEQLIKAESSIEGMNGAEYFFHDIMNTTDTYVSWPCRLKIGAKSKKDPHVRIVGKVDQVQRAKERILSSLDSRGTRVIMKMDVSYTDHSYIIGRGGNNIKRIMDDTHTHIHFPDSNRSNPTEKSNQVSLCGSLEGVERARALVRLSTPLLISFEMPVMGPNKPQPDHETPYIKMIETKFNVQVIFSTRPKLHTSLVLVKGSEKESAQVRDATQLLINFACESIASQILVNVQMEISPQHHEIVKGKNNVNLLSIMERTQTKIIFPDLSDMNVKPLKKSQVTISGRIDDVYLARQQLLGNLPVALIFDFPDNHNDASEIMSLNTKYGVYITLRQKQRQSTLAIVVKGVEKFIDKIYEARQEILRLATPFVKPEIPDYYFMPKDKDLNLAYRTQLTALLAGYVDSPKTPSLLPPSLAGQLTPYANNNHLLLNANGLATPTGVCAPTQKYMQLHNSFQQAQNRSMVAGGQSNNGNYLQVPGAVAPPLKPPTVSPRNSCSQNTSGYQSFSSSTTSLEQSYPPYAQLPGTVSSTSSSTAGSQNRAHYSPDSTYGSEGGGVGGGGGGGARLGRRLSDGVLLGLSNSNGGGGNSGGAHLLPGSAESYRSLHYDLGGNKHSGHRAFDFDMKRALGYKAMERTPVAGELRTPTTAWMGMGLSSTSPAPAPLENGENGAAGGGASSGWRLPPGLGSPYGLSATTGLLDATPVNRRMQLAKHKDIQTLLTSLGLEHYIKIFVLNEIDLEVFTTLTEENLMELGIAAFGARKKLLTAIHTLLANEAACSTMPSSSSSQNSSSPRFSGSAAPGAERRPSNQW | ||||||
Modified residue | 557 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 586 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 639 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 642 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 643 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 644 | Phosphotyrosine | ||||
Sequence: Y | ||||||
Modified residue | 646 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 666 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 692 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 695 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 696 | Phosphotyrosine | ||||
Sequence: Y |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Abundantly expressed in ovaries and early embryos.
Developmental stage
Expressed in the developing ovary. First detectable at stages 3 and 4 of oogenesis but remains very faint until stage 5, when the protein level increases substantially. In stages 4 to 6 is visible throughout the oocyte cytoplasm but is enriched at the osterior pole of the oocyte. During stages 7 to 9 is abundant in the oocyte cytoplasm, with some enrichment at the anterior of the oocyte and around the oocyte cortex. In stage 10 and in later stages is expressed at high levels in the nurse cells (at protein level).
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 172-239 | KH 1 | ||||
Sequence: RVIMKMDVSYTDHSYIIGRGGNNIKRIMDDTHTHIHFPDSNRSNPTEKSNQVSLCGSLEGVERARALV | ||||||
Domain | 324-392 | KH 2 | ||||
Sequence: LVNVQMEISPQHHEIVKGKNNVNLLSIMERTQTKIIFPDLSDMNVKPLKKSQVTISGRIDDVYLARQQL | ||||||
Region | 559-660 | Disordered | ||||
Sequence: VAGGQSNNGNYLQVPGAVAPPLKPPTVSPRNSCSQNTSGYQSFSSSTTSLEQSYPPYAQLPGTVSSTSSSTAGSQNRAHYSPDSTYGSEGGGVGGGGGGGAR | ||||||
Compositional bias | 586-641 | Polar residues | ||||
Sequence: SPRNSCSQNTSGYQSFSSSTTSLEQSYPPYAQLPGTVSSTSSSTAGSQNRAHYSPD | ||||||
Region | 751-772 | Disordered | ||||
Sequence: TSPAPAPLENGENGAAGGGASS | ||||||
Domain | 805-868 | SAM | ||||
Sequence: AKHKDIQTLLTSLGLEHYIKIFVLNEIDLEVFTTLTEENLMELGIAAFGARKKLLTAIHTLLAN | ||||||
Region | 874-905 | Disordered | ||||
Sequence: TMPSSSSSQNSSSPRFSGSAAPGAERRPSNQW |
Sequence similarities
Belongs to the BicC family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length905
- Mass (Da)97,849
- Last updated1997-07-01 v2
- Checksum22FC1CD4BB231603
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
E2QCR4 | E2QCR4_DROME | BicC | 905 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 586-641 | Polar residues | ||||
Sequence: SPRNSCSQNTSGYQSFSSSTTSLEQSYPPYAQLPGTVSSTSSSTAGSQNRAHYSPD |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U15928 EMBL· GenBank· DDBJ | AAB51692.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014134 EMBL· GenBank· DDBJ | AAN10927.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014134 EMBL· GenBank· DDBJ | AAN10928.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT023837 EMBL· GenBank· DDBJ | AAZ86758.1 EMBL· GenBank· DDBJ | mRNA |