Q23970 · PBP6_DROME
- ProteinPheromone-binding protein-related protein 6
- GeneObp83b
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids141 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | odorant binding | |
Biological Process | sensory perception of chemical stimulus | |
Biological Process | sensory perception of smell |
Names & Taxonomy
Protein names
- Recommended namePheromone-binding protein-related protein 6
- Short namesPBPRP-6
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ23970
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Secreted in the lumen of olfactory hairs.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-16 | |||||
Sequence: MVKYPLILLLIGCAAA | ||||||
Chain | PRO_0000012591 | 17-141 | Pheromone-binding protein-related protein 6 | |||
Sequence: QEPRRDGEWPPPAILKLGKHFHDICAPKTGVTDEAIKEFSDGQIHEDEALKCYMNCLFHEFEVVDDNGDVHMEKVLNAIPGEKLRNIMMEASKGCIHPEGDTLCHKAWWFHQCWKKADPVHYFLV | ||||||
Disulfide bond | 41↔72 | |||||
Sequence: CAPKTGVTDEAIKEFSDGQIHEDEALKCYMNC | ||||||
Disulfide bond | 68↔120 | |||||
Sequence: CYMNCLFHEFEVVDDNGDVHMEKVLNAIPGEKLRNIMMEASKGCIHPEGDTLC | ||||||
Disulfide bond | 111↔129 | |||||
Sequence: CIHPEGDTLCHKAWWFHQC |
Keywords
- PTM
Proteomic databases
Expression
Tissue specificity
Antenna. Mostly expressed in two types of sensory hairs, sensilla trichodea and small sensilla basiconica, in the ventro-lateral region of the third antennal segment (at protein level).
Developmental stage
Expressed in adult but not in larval olfactory organs.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length141
- Mass (Da)16,112
- Last updated2005-01-04 v2
- ChecksumAD7E6D3E9DEF0538
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 2 | in Ref. 1; AAA21356 | ||||
Sequence: V → L |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U02543 EMBL· GenBank· DDBJ | AAA21356.1 EMBL· GenBank· DDBJ | mRNA | ||
U81502 EMBL· GenBank· DDBJ | AAB51683.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ574644 EMBL· GenBank· DDBJ | CAE00882.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ574762 EMBL· GenBank· DDBJ | CAE00417.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ574763 EMBL· GenBank· DDBJ | CAE00419.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ574764 EMBL· GenBank· DDBJ | CAE00421.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ574765 EMBL· GenBank· DDBJ | CAE00423.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ574766 EMBL· GenBank· DDBJ | CAE00425.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ574767 EMBL· GenBank· DDBJ | CAE00427.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ574768 EMBL· GenBank· DDBJ | CAE00429.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ574769 EMBL· GenBank· DDBJ | CAE00431.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ574770 EMBL· GenBank· DDBJ | CAE00433.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ574771 EMBL· GenBank· DDBJ | CAE00435.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ574772 EMBL· GenBank· DDBJ | CAE00437.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ574773 EMBL· GenBank· DDBJ | CAE00439.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ574774 EMBL· GenBank· DDBJ | CAE00441.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014297 EMBL· GenBank· DDBJ | AAF51928.1 EMBL· GenBank· DDBJ | Genomic DNA |