Q23280 · DAF41_CAEEL
- ProteinCo-chaperone protein daf-41
- Genedaf-41
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids175 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Co-chaperone for hsp90/daf-21 (PubMed:20880838).
Involved in regulation of longevity, larval entry and exit from the dauer stage of development and response to environmental cues, such as oxidative stress, in a temperature-dependent manner. Role in daf-16 and hsf-1 inhibition at elevated temperatures (PubMed:25830239).
Involved in regulation of longevity, larval entry and exit from the dauer stage of development and response to environmental cues, such as oxidative stress, in a temperature-dependent manner. Role in daf-16 and hsf-1 inhibition at elevated temperatures (PubMed:25830239).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | myofibril | |
Cellular Component | nucleus | |
Cellular Component | protein folding chaperone complex | |
Molecular Function | Hsp90 protein binding | |
Molecular Function | protein-folding chaperone binding | |
Biological Process | chaperone-mediated protein complex assembly | |
Biological Process | protein folding | |
Biological Process | protein maturation by protein folding |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCo-chaperone protein daf-41
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ23280
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Phenotypes & Variants
Disruption phenotype
Resistant to oxidative and heat stress. At increased temperatures, there is increased longevity and an increased propensity of larvae to form dauer. At decreased temperatures, lifespan is shorter. Defective chemotaxis in response to toxins.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000218955 | 1-175 | Co-chaperone protein daf-41 | |||
Sequence: MAKQPTVLWAQRESLVYLTIEVDEAKIEELKGEGNKLHFQGSSKTDKYEATLEFFDEIDPASVKHTGSSTRVVEITVQKKTPAWWPRLLQNKGKVHWLKVDFGKWKDEDEDDEAEDAGAGIGGGMANGFDLNQYMSQMGGAGGADFGGLEDDEEDDDMPDLEDNEEEEGKNGTRA |
Proteomic databases
Expression
Tissue specificity
Expressed in anterior and posterior neurons including ASE, AWC, ASI and ADL amphids and phasmid sensory neurons, peripheral neurons and ventral cord motorneurons. Additionally expressed in body wall muscle, pharynx, vulva, germ cells and intestine.
Developmental stage
Expressed from embryo to adulthood.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 2-89 | CS | ||||
Sequence: AKQPTVLWAQRESLVYLTIEVDEAKIEELKGEGNKLHFQGSSKTDKYEATLEFFDEIDPASVKHTGSSTRVVEITVQKKTPAWWPRLL | ||||||
Region | 109-175 | Disordered | ||||
Sequence: DEDDEAEDAGAGIGGGMANGFDLNQYMSQMGGAGGADFGGLEDDEEDDDMPDLEDNEEEEGKNGTRA | ||||||
Compositional bias | 147-166 | Acidic residues | ||||
Sequence: GGLEDDEEDDDMPDLEDNEE |
Sequence similarities
Belongs to the p23/wos2 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length175
- Mass (Da)19,431
- Last updated1996-11-01 v1
- ChecksumD5C136F30446E37A
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 147-166 | Acidic residues | ||||
Sequence: GGLEDDEEDDDMPDLEDNEE |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
FO080775 EMBL· GenBank· DDBJ | CCD66668.1 EMBL· GenBank· DDBJ | Genomic DNA |