Q23049 · TTC8_CAEEL
- ProteinTetratricopeptide repeat protein 8
- Genebbs-8
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids506 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Component of the BBSome complex (By similarity).
The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia (By similarity).
The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function (By similarity).
Required for proper BBSome complex assembly and its ciliary localization (PubMed:22922713).
Required for cilia biogenesis and both the assembly and movement of intraflagellar transport proteins along the ciliary axoneme (PubMed:15231740, PubMed:17000880, PubMed:22022287, PubMed:22922713, PubMed:27930654).
Plays a role in guanylyl cyclase localization in the ring-like structures at the base of the finger compartment in AFD sensory neurons (PubMed:25335890).
The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia (By similarity).
The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function (By similarity).
Required for proper BBSome complex assembly and its ciliary localization (PubMed:22922713).
Required for cilia biogenesis and both the assembly and movement of intraflagellar transport proteins along the ciliary axoneme (PubMed:15231740, PubMed:17000880, PubMed:22022287, PubMed:22922713, PubMed:27930654).
Plays a role in guanylyl cyclase localization in the ring-like structures at the base of the finger compartment in AFD sensory neurons (PubMed:25335890).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | BBSome | |
Cellular Component | ciliary basal body | |
Cellular Component | ciliary base | |
Cellular Component | cilium | |
Cellular Component | cytoplasm | |
Cellular Component | dendrite terminus | |
Cellular Component | neuron projection | |
Cellular Component | non-motile cilium | |
Biological Process | chemotaxis | |
Biological Process | cilium assembly | |
Biological Process | intraciliary transport | |
Biological Process | non-motile cilium assembly | |
Biological Process | olfactory learning | |
Biological Process | positive regulation of intraciliary anterograde transport | |
Biological Process | positive regulation of intraciliary retrograde transport | |
Biological Process | positive regulation of protein localization to ciliary membrane | |
Biological Process | protein localization to microvillus membrane | |
Biological Process | protein transport |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameTetratricopeptide repeat protein 8
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ23049
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localized at the ciliary base and also in ring-like structures between the base of the AFD sensory neuron finger compartment and the dendritic membrane.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Mutants have normal body morphology, but with reduced body length and width, delayed larval development and decreased roaming movements (PubMed:22022287).
May exhibit defective chemotaxis tendencies (PubMed:15231740).
Defective sensory cilia structure and function (PubMed:15231740, PubMed:22022287).
This is characterized by increased accumulation and mislocalization of intraflagellar transport proteins and impaired movement of intraflagellar transport proteins such as rab-28 along the ciliary axoneme (PubMed:15231740, PubMed:27930654).
Disrupted assembly of the BBSome complex at the base of the cilia (PubMed:22922713).
Impaired localization of the guanylyl cyclase proteins, gcy-8, gcy-18 and gcy-23, within AFD sensory neurons, with accumulation along the dendrite as well as in the finger compartment of AFD neurons (PubMed:25335890).
Thermotaxis defects and impaired tendencies to migrate to a food source (PubMed:25335890).
May exhibit defective chemotaxis tendencies (PubMed:15231740).
Defective sensory cilia structure and function (PubMed:15231740, PubMed:22022287).
This is characterized by increased accumulation and mislocalization of intraflagellar transport proteins and impaired movement of intraflagellar transport proteins such as rab-28 along the ciliary axoneme (PubMed:15231740, PubMed:27930654).
Disrupted assembly of the BBSome complex at the base of the cilia (PubMed:22922713).
Impaired localization of the guanylyl cyclase proteins, gcy-8, gcy-18 and gcy-23, within AFD sensory neurons, with accumulation along the dendrite as well as in the finger compartment of AFD neurons (PubMed:25335890).
Thermotaxis defects and impaired tendencies to migrate to a food source (PubMed:25335890).
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000435001 | 1-506 | Tetratricopeptide repeat protein 8 | |||
Sequence: MSGESVIEFTGFIKACRLFRENRLAEAEAVCTNLLRKNPLDQATWALKMQCLSDSTYVDELENEDMGLAETFLDQNVIAPNARPGTSFARPKTSAKGVNPILRPTTNAGRPLSGVVRPQSSFKSGSMDQAVRTARTAKTARAVSSTSARNMRLGTASMAAGADGEFVNLARLNIDKYAADPQVNRQLFEYVFYYLNDIRVAHQIAGTASKAAGFEDYYWKNQLAKCYLRLGMLQDATKQLQSSLEQKKLIETFALLSKAYNRVDQPMAALKTYSAGLEVFPENVTMLTGMARVQEALGEYDESVKLYKRVLDAESNNIEAIACVATTYYYGGKPELAMRYYRRILQMGVSSPELFLNIGLCCMAAQQFDFALSSILRAQSTMTDDVAADVWYNIGQILVDIGDLVSAARSFRIALSHDPDHSESLVNLGILKHREGKIDEARSLYSSATSKNPYMFEGNYNLGLVSFTQGKYHECRELIEKALAAFPEHEHCKKILNHLKPLYESI |
Proteomic databases
Expression
Tissue specificity
Expressed in head and tail neurons (PubMed:15231740).
Expressed in ciliated male tail-neurons (PubMed:14520415).
Expressed in thermosensory and CO2 sensory AFD neurons (PubMed:25335890).
Expressed in ciliated male tail-neurons (PubMed:14520415).
Expressed in thermosensory and CO2 sensory AFD neurons (PubMed:25335890).
Developmental stage
Expressed from the embryonic stage to adulthood. Expressed in embryos from the 1.5-fold stage, with expression increasing to the 3-fold stage. Expressed in ciliated cells including amphid and both inner and outer labial neurons of the head at larval stages L1 and L2. Expressed in both phasmid neurons PHA and PHB in the tail and in the PDE sensory neuron in the mid-body at larval stage L3 and L4.
Gene expression databases
Interaction
Subunit
Part of BBSome complex, that contains at least bbs-1, bbs-2, bbs-4, bbs-5, osm-12, bbs-8/ttc-8 and bbs-9.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 83-112 | Disordered | ||||
Sequence: RPGTSFARPKTSAKGVNPILRPTTNAGRPL | ||||||
Repeat | 217-250 | TPR 1 | ||||
Sequence: YYWKNQLAKCYLRLGMLQDATKQLQSSLEQKKLI | ||||||
Repeat | 251-283 | TPR 2 | ||||
Sequence: ETFALLSKAYNRVDQPMAALKTYSAGLEVFPEN | ||||||
Repeat | 284-317 | TPR 3 | ||||
Sequence: VTMLTGMARVQEALGEYDESVKLYKRVLDAESNN | ||||||
Repeat | 319-351 | TPR 4 | ||||
Sequence: EAIACVATTYYYGGKPELAMRYYRRILQMGVSS | ||||||
Repeat | 353-385 | TPR 5 | ||||
Sequence: ELFLNIGLCCMAAQQFDFALSSILRAQSTMTDD | ||||||
Repeat | 388-421 | TPR 6 | ||||
Sequence: ADVWYNIGQILVDIGDLVSAARSFRIALSHDPDH | ||||||
Repeat | 423-455 | TPR 7 | ||||
Sequence: ESLVNLGILKHREGKIDEARSLYSSATSKNPYM | ||||||
Repeat | 456-489 | TPR 8 | ||||
Sequence: FEGNYNLGLVSFTQGKYHECRELIEKALAAFPEH |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length506
- Mass (Da)56,304
- Last updated2002-10-01 v2
- ChecksumE72170400424F53B
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX284605 EMBL· GenBank· DDBJ | CCD74239.1 EMBL· GenBank· DDBJ | Genomic DNA |