Q22795 · KMT5A_CAEEL
- ProteinHistone-lysine N-methyltransferase set-1
- Geneset-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids242 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Histone methyltransferase that specifically monomethylates 'Lys-20' of histone H4 (H4K20me1) (PubMed:23028348).
H4K20me1 is enriched on hermaphrodite X chromosomes and during mitosis (PubMed:22393255, PubMed:23028348).
Involved in dosage compensation by repression of X-linked gene expression in hermaphrodites (PubMed:23028348).
Plays a role in growth and body fat regulation downstream of the TOR complex 2 pathway (PubMed:23884442).
H4K20me1 is enriched on hermaphrodite X chromosomes and during mitosis (PubMed:22393255, PubMed:23028348).
Involved in dosage compensation by repression of X-linked gene expression in hermaphrodites (PubMed:23028348).
Plays a role in growth and body fat regulation downstream of the TOR complex 2 pathway (PubMed:23884442).
Catalytic activity
- L-lysyl20-[histone H4] + S-adenosyl-L-methionine = H+ + N6-methyl-L-lysyl20-[histone H4] + S-adenosyl-L-homocysteine
Features
Showing features for binding site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Cellular Component | polytene chromosome | |
Cellular Component | Set1C/COMPASS complex | |
Molecular Function | histone H4K20 methyltransferase activity | |
Molecular Function | histone H4K20 monomethyltransferase activity | |
Molecular Function | RNA binding | |
Biological Process | embryo development ending in birth or egg hatching | |
Biological Process | methylation | |
Biological Process | regulation of DNA damage response, signal transduction by p53 class mediator | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameHistone-lysine N-methyltransferase set-1
- EC number
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ22795
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Mutant animals lack methylation of 'Lys-20' of histone H4 (H4K20me) (PubMed:23028348).
In a glp-1(e2141) mutant background which lacks a germline, the X-linked genes aco-1, ajm-1 and apl-1 are up-regulated (PubMed:23028348).
RNAi-mediated knockdown leads to embryonic lethality in a mutant background of the dosage compensation proteins dpy-21 or dpy-28 (PubMed:23028348).
Increases 'Lys-16' acetylation of histone H4 on hermaphrodite X chromosomes (PubMed:22393255).
In the TOR complex 2 mutant background rict-1, suppresses the growth delay and elevated body fat index (PubMed:23884442).
Causes mitotic chromosome segregation defects and chromosome bridges resulting in delayed or arrested embryonic development and embryonic lethality (PubMed:28867287).
In a glp-1(e2141) mutant background which lacks a germline, the X-linked genes aco-1, ajm-1 and apl-1 are up-regulated (PubMed:23028348).
RNAi-mediated knockdown leads to embryonic lethality in a mutant background of the dosage compensation proteins dpy-21 or dpy-28 (PubMed:23028348).
Increases 'Lys-16' acetylation of histone H4 on hermaphrodite X chromosomes (PubMed:22393255).
In the TOR complex 2 mutant background rict-1, suppresses the growth delay and elevated body fat index (PubMed:23884442).
Causes mitotic chromosome segregation defects and chromosome bridges resulting in delayed or arrested embryonic development and embryonic lethality (PubMed:28867287).
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000097694 | 1-242 | Histone-lysine N-methyltransferase set-1 | |||
Sequence: MKVAAKKLATSRMRKDRAAAASPSSDIENSENPSSLASHSSSSGRMTPSKNTRSRKGVSVKDVSNHKITEFFQVRRSNRKTSKQISDEAKHALRDTVLKGTNERLLEVYKDVVKGRGIRTKVNFEKGDFVVEYRGVMMEYSEAKVIEEQYSNDEEIGSYMYFFEHNNKKWCIDATKESPWKGRLINHSVLRPNLKTKVVEIDGSHHLILVARRQIAQGEELLYDYGDRSAETIAKNPWLVNT |
Proteomic databases
Expression
Tissue specificity
In embryos, it is expressed ubiquitously. In late embryos, it is expressed in hypodermal seam cells. In L3 and L4 larvae and thereafter, it is expressed in vulval precursor cells. In adult males, it is also expressed in 6 unidentified posterior cells.
Developmental stage
Highly expressed in eggs, then decreases.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-61 | Disordered | ||||
Sequence: MKVAAKKLATSRMRKDRAAAASPSSDIENSENPSSLASHSSSSGRMTPSKNTRSRKGVSVK | ||||||
Compositional bias | 23-54 | Polar residues | ||||
Sequence: PSSDIENSENPSSLASHSSSSGRMTPSKNTRS | ||||||
Domain | 104-226 | SET | ||||
Sequence: RLLEVYKDVVKGRGIRTKVNFEKGDFVVEYRGVMMEYSEAKVIEEQYSNDEEIGSYMYFFEHNNKKWCIDATKESPWKGRLINHSVLRPNLKTKVVEIDGSHHLILVARRQIAQGEELLYDYG |
Sequence similarities
Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. PR/SET subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length242
- Mass (Da)27,568
- Last updated1999-01-01 v2
- Checksum0F752B79505AFA99
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
G8JY06 | G8JY06_CAEEL | set-1 | 105 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 23-54 | Polar residues | ||||
Sequence: PSSDIENSENPSSLASHSSSSGRMTPSKNTRS |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
FO080366 EMBL· GenBank· DDBJ | CCD63213.1 EMBL· GenBank· DDBJ | Genomic DNA |