Q21540 · CUT6_CAEEL
- ProteinCuticlin-6
- Genecut-6
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids572 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Plays a role in alae formation in dauer larvae probably by regulating cuticle assembly.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | alae of collagen and cuticulin-based cuticle extracellular matrix | |
Cellular Component | plasma membrane | |
Molecular Function | structural constituent of cuticle |
Names & Taxonomy
Protein names
- Recommended nameCuticlin-6
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ21540
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass type I membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 25-541 | Extracellular | ||||
Sequence: NPIDNGLVDSELIHECVTHKAVEVILLLDASGSIGDDTFKKQLSFAMHLASRLNISEDGSHMALIQYAETPKLEFSLGQFNHPTQLEWAIQRIEYQSGATNTGQALRLTLEKGLQGARPGIPKVAIVITDGQSQDDVSEPSQLLRDADVMVYAIGVTNLVNVHQLHQMTGNPVRVFTVESFEQLDRALADSLTWSMCKTEFRPGTPEIICGPDRIGVKASTKQPFEGNVFVMDHYHDEECRAGPEKFPDSRSIGLTVPFSACNVHRYRSLNPKGIFVEVSIVFMFHSLFMTKTDQTVKVQCFYMEADKHVTVPLSVSMITTVFREQIYQMPQCAYTLRKGAPDGPIVRFATLGESVYHRWECIEVEGADKDTFGMLVHSCYVDNGYGDRVDILDSNGCGLDAVLLSTPDYDTSLRLATKPYHVFKYADRPVLQFQCQITLCLKYDGGCEGITPPQNCKKLPGEDGHHHHHHPEKRRKLVRRLADGVGTIDVFTDSVTVLEQEPACQQPLPYPLINTN | ||||||
Transmembrane | 542-562 | Helical | ||||
Sequence: LWIMGIITLTNIFVFILTVWF | ||||||
Topological domain | 563-572 | Cytoplasmic | ||||
Sequence: TFRKRRCKPA |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown results in shorter and fatter dauer phase animals (dumpy phenotype) (PubMed:12921736, PubMed:15936343).
RNAi-mediated knockdown results in a folded pharynx in some animals (PubMed:12921736).
RNAi-mediated knockdown results in no alae formation (PubMed:12921736).
However, other studies indicate that RNAi-mediated knockdown results in partially formed alae (PubMed:15936343).
RNAi-mediated knockdown results in a folded pharynx in some animals (PubMed:12921736).
RNAi-mediated knockdown results in no alae formation (PubMed:12921736).
However, other studies indicate that RNAi-mediated knockdown results in partially formed alae (PubMed:15936343).
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-24 | |||||
Sequence: MRPIPYDISLSITSFLSLILICSA | ||||||
Chain | PRO_5004199393 | 25-572 | Cuticlin-6 | |||
Sequence: NPIDNGLVDSELIHECVTHKAVEVILLLDASGSIGDDTFKKQLSFAMHLASRLNISEDGSHMALIQYAETPKLEFSLGQFNHPTQLEWAIQRIEYQSGATNTGQALRLTLEKGLQGARPGIPKVAIVITDGQSQDDVSEPSQLLRDADVMVYAIGVTNLVNVHQLHQMTGNPVRVFTVESFEQLDRALADSLTWSMCKTEFRPGTPEIICGPDRIGVKASTKQPFEGNVFVMDHYHDEECRAGPEKFPDSRSIGLTVPFSACNVHRYRSLNPKGIFVEVSIVFMFHSLFMTKTDQTVKVQCFYMEADKHVTVPLSVSMITTVFREQIYQMPQCAYTLRKGAPDGPIVRFATLGESVYHRWECIEVEGADKDTFGMLVHSCYVDNGYGDRVDILDSNGCGLDAVLLSTPDYDTSLRLATKPYHVFKYADRPVLQFQCQITLCLKYDGGCEGITPPQNCKKLPGEDGHHHHHHPEKRRKLVRRLADGVGTIDVFTDSVTVLEQEPACQQPLPYPLINTNLWIMGIITLTNIFVFILTVWFTFRKRRCKPA | ||||||
Glycosylation | 78 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Developmental stage
Expressed in late embryos (PubMed:12921736).
At the L1 larval stage and during the dauer stages, it is expressed adjacent to the lateral edges of the alae (at protein level) (PubMed:12921736).
In the L2 pre-dauer stage, expressed in the head hypodermal cells hyp3, hyp4, hyp5, hyp6 and hyp7, along the main body and in tail hyp8, hyp9, hyp10 and hyp11 (PubMed:12921736).
Not expressed at adult stages (at protein level) (PubMed:12921736).
At the L1 larval stage and during the dauer stages, it is expressed adjacent to the lateral edges of the alae (at protein level) (PubMed:12921736).
In the L2 pre-dauer stage, expressed in the head hypodermal cells hyp3, hyp4, hyp5, hyp6 and hyp7, along the main body and in tail hyp8, hyp9, hyp10 and hyp11 (PubMed:12921736).
Not expressed at adult stages (at protein level) (PubMed:12921736).
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 47-216 | VWFA | ||||
Sequence: EVILLLDASGSIGDDTFKKQLSFAMHLASRLNISEDGSHMALIQYAETPKLEFSLGQFNHPTQLEWAIQRIEYQSGATNTGQALRLTLEKGLQGARPGIPKVAIVITDGQSQDDVSEPSQLLRDADVMVYAIGVTNLVNVHQLHQMTGNPVRVFTVESFEQLDRALADSL | ||||||
Domain | 233-479 | ZP | ||||
Sequence: ICGPDRIGVKASTKQPFEGNVFVMDHYHDEECRAGPEKFPDSRSIGLTVPFSACNVHRYRSLNPKGIFVEVSIVFMFHSLFMTKTDQTVKVQCFYMEADKHVTVPLSVSMITTVFREQIYQMPQCAYTLRKGAPDGPIVRFATLGESVYHRWECIEVEGADKDTFGMLVHSCYVDNGYGDRVDILDSNGCGLDAVLLSTPDYDTSLRLATKPYHVFKYADRPVLQFQCQITLCLKYDGGCEGITPPQ |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length572
- Mass (Da)64,132
- Last updated2004-07-05 v2
- ChecksumE653C6335EC5F144
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX284603 EMBL· GenBank· DDBJ | CAA97806.2 EMBL· GenBank· DDBJ | Genomic DNA |