Q20937 · CNOT1_CAEEL
- ProteinCCR4-NOT transcription complex subunit let-711
- Genelet-711
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids2641 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Scaffolding component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation (PubMed:23843623, PubMed:28204614).
Positively regulates the accumulation of the CCR4-NOT complex component ccr-1 (PubMed:23843623).
Within the complex promotes germ cell development and fertility in hermaphrodites (PubMed:23843623).
Additional complex functions may be a consequence of its influence on mRNA expression (By similarity).
Its scaffolding function implies its interaction with the catalytic complex module and diverse RNA-binding proteins mediating the complex recruitment to selected mRNA 3'UTRs (By similarity).
Mediates the recruitment of the CCR4-NOT complex to miRNA targets and to the RISC complex (Probable). Acts as a transcriptional repressor (By similarity).
Represses the ligand-dependent transcriptional activation by nuclear receptors (By similarity).
In embryos, plays a role in female pronucleus and mitotic spindle positioning during the first cleavage divisions after fertilization (PubMed:16971515).
This may partly be through negatively regulating the accumulation of zyg-9 at the centrosome (PubMed:16971515).
Negatively regulates the formation of long astral microtubules in developing embryos (PubMed:16971515).
Required for the stabilization and degradation of maternal mRNAs such as nos-2 in somatic blastomeres (PubMed:18692039).
Positively regulates the accumulation of the CCR4-NOT complex component ccr-1 (PubMed:23843623).
Within the complex promotes germ cell development and fertility in hermaphrodites (PubMed:23843623).
Additional complex functions may be a consequence of its influence on mRNA expression (By similarity).
Its scaffolding function implies its interaction with the catalytic complex module and diverse RNA-binding proteins mediating the complex recruitment to selected mRNA 3'UTRs (By similarity).
Mediates the recruitment of the CCR4-NOT complex to miRNA targets and to the RISC complex (Probable). Acts as a transcriptional repressor (By similarity).
Represses the ligand-dependent transcriptional activation by nuclear receptors (By similarity).
In embryos, plays a role in female pronucleus and mitotic spindle positioning during the first cleavage divisions after fertilization (PubMed:16971515).
This may partly be through negatively regulating the accumulation of zyg-9 at the centrosome (PubMed:16971515).
Negatively regulates the formation of long astral microtubules in developing embryos (PubMed:16971515).
Required for the stabilization and degradation of maternal mRNAs such as nos-2 in somatic blastomeres (PubMed:18692039).
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | CCR4-NOT complex | |
Cellular Component | CCR4-NOT core complex | |
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Cellular Component | P-body | |
Molecular Function | molecular adaptor activity | |
Biological Process | astral microtubule organization | |
Biological Process | establishment of mitotic spindle localization | |
Biological Process | negative regulation of translation | |
Biological Process | nematode larval development | |
Biological Process | nuclear-transcribed mRNA catabolic process | |
Biological Process | nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay | |
Biological Process | nuclear-transcribed mRNA poly(A) tail shortening | |
Biological Process | oogenesis | |
Biological Process | positive regulation of transcription elongation by RNA polymerase II | |
Biological Process | regulation of gene expression | |
Biological Process | regulatory ncRNA-mediated gene silencing |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameCCR4-NOT transcription complex subunit let-711
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ20937
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown results in sterility and the production of inviable embryos which are osmotically sensitive, exhibit nuclear rotation defects and irregular positioning of the mitotic spindle which is located towards the posterior or lateral cortex during anaphase (PubMed:16971515, PubMed:23843623).
RNAi-mediated knockdown may also result in a reduced brood size and larval lethality (PubMed:23843623).
RNAi-mediated knockdown disrupts the arrangement and differentiation of oocytes in the proximal region and as a result small oocyte-like cells arrange in several rows in the germline (PubMed:23843623).
RNAi-mediated knockdown reduces the levels of ccf-1, but does not alter ccr-4 levels (PubMed:23843623).
RNAi-mediated knockdown results in reduced global poly(A) tail deadenylation (PubMed:23843623).
RNAi-mediated knockdown results in reduces degradation of nos-2 mRNA, impairs the recruitment of lsm-1 and decreases the number of patr-1-positive granules in somatic blastomeres (PubMed:18692039).
RNAi-mediated knockdown may also result in a reduced brood size and larval lethality (PubMed:23843623).
RNAi-mediated knockdown disrupts the arrangement and differentiation of oocytes in the proximal region and as a result small oocyte-like cells arrange in several rows in the germline (PubMed:23843623).
RNAi-mediated knockdown reduces the levels of ccf-1, but does not alter ccr-4 levels (PubMed:23843623).
RNAi-mediated knockdown results in reduced global poly(A) tail deadenylation (PubMed:23843623).
RNAi-mediated knockdown results in reduces degradation of nos-2 mRNA, impairs the recruitment of lsm-1 and decreases the number of patr-1-positive granules in somatic blastomeres (PubMed:18692039).
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000453922 | 1-2641 | CCR4-NOT transcription complex subunit let-711 | |||
Sequence: MHSTSGLAPVFRVEENHMIRNRENLERPISKKGTITLLSKMPMGFVLNSCSCAYIDNLLAHSSIHRVKPHSFMIQRLVVICGRSSPSLPNHAANIILSAFNFCQIEAPAKKFLEEDAALSLFHTILSYSTVTQINRSGIEILGAQRLTSALCDLIYAYTKTMDDMVASKTLTHLCKKLAGLFDPLVVLPFISKLAKSRRLRHYLQPLFLGHCEYTSDTWGVSPEGAEIYNQIARGNFTTQTLIEIVQTFLEKEVKEVIISSTTDPIKLVQYLISCSNPDNTEIVQALAFLLYSNTKLLPAGSGGTIDMDVQAADTITTARLGDTKFTQPVKDALLDSGREALLRRMEIYGVSLLSSVENFVTELKQAPIQKKMVTNNSVANAILYMLQYNFDMSRDIENGRQDNSPFWGGSNFVIGITRFVEEQQAAVRDMEGFSDWYPDINWVEVIKEFDSEEFAICRQTIIMFADIFPIMFQPQNFPVSFFLTPWRYYDHQLRLFEFMIEYADVWNISQYPHTKVLTPDLNLKTIPDDSTSVVQLWNCQEFSNCLLTIANSQPSLYNAIKQFYNVGSMQAGDVSMLALILSPTQWTTGRQDLIRHFLPSFILKSPNVTPVLNLVWNDTSLSKHMRQHVIYCLTSMHAADSSQLAKILDVAHDIKPTGLSELLNQAPKHLAFMVDLACLASKRDYLNLEKWIEDKEKAHGEAMTVAVLQFIQKKYQHAQLVAAIAPKTQATTPGAPSEPLQVLIPFVSKRARKPLRQQFPLVFQVMKENSGRSSSVSSGGHVQQSSGSQPQQQQFGGGSGLPPSGVVPVQQQPQQPPSLQQQHSQQSLPTPPTTSQQQIHVQQSVPGPIQRPAQFAPQPMFPPQAQAQHQHQHMMGQPPPSSQNAQPGMNLLMNMSPFASGNNRDLLKVVQPAPPPPSSMSPSTQMMRSLIPPLTQRQNSNSGWHAAPAPQRPSGPPTPQQQMDFRGQIQEFAPQGPHQLQRSGSVTGRSMGIVGQKTSSNFSVGAPIPGSAAATAAAAANVQQPMNEDFQSMTFAEDIQEEANSYFEKIYSVNNAMSVENLIDLLKRFRVSNDRRERLVLACVVKNLFEEYRFFHEYPERELRTTAAVYGGIIREDIISNVQFATAVRKVIESLSADPNTMLWTFGIVALQHCRSKLCAYPKVCQMIVSSENFARFPQLLKDYVIAGVKGELPPEGGRHTPVGSAQAGSASSTPTPAAAPTNWGAVARAASVDPKNSLPANRTGNVLSYTNVDTLVMATNKDGAEIAQPAEAIVDKISFLFNNLSQSNLIQKKDEVVEMISDHGDAFTLWLAQYIVMKRVSIEQNFQPLYNQFVNAIENPYLDQCIKRETFRNIRILLRTDKRTTVASNYSDRQLLKNLGSWLGAITIARNKPILLNDLDLKSLLLEAYYKGQAELLYVVPFISKILTACSKTSLFTPTCAWIRSILKVLAELHNEPDLKINLKFEIEVLCKELNVDLNQLQMDGILKDTEKLVRVPQQLCDVKLLTRPEAASPVQSKIHMSGSAEQLSGMSPAIPDQVKPATPQPTEAELQSGTGGGGSQGAEAQVVPNVTHFAYHDINVLTYDGLIPHVKIVSHLPLFQLHPHAKHLVRPAMIHAIKELIGPVTERALKIAMTVTESLVRKDFALDPEEQNLRAASFHMMRAMTAGMAMITCRDPLASSMHSNLANAFSSSLRSTAANPEMKQMIEDAAATITQDNVELSTNFIVKTACEKATQDIEKRLEADYQKRIAAKAEMSFYRDEIAAAIHAQLPKAIATVPGPTDKALMGIYDQFSSRICGFKANSGEDPVSAEPGSGAITPVQTQSKEMELVCQQLQVIIKEVDQTTQAQPHLSNSAFQTVCLMRELMQNVISTKDANHLMILVTRSTEHLLHAYRLEGTPPKNLLDVEWARRLRDLFIGLMRLLQNYFPLVELSRRITTAIMQIRSDYKWNMEGIEILFKQNLLQSVLWDQHLAGSMDNGGNMEAVLFAQKFVRSIGGGDMSRIQFLKERFPLTCEQLTKLHQLQSATRTEGMNNAMNNGAGNAAHHHAGLQQQPPVALPMEAAPMPQASADAMAQRGYDDQEMTAKVEIIMREWIGLCYSPTGQRSPQESLAQMIQLMHEHGVLATDDKITQFFRLCVENCVDISVRVMKSEQLANGLPTTLIRHRCYYTLDAFVKLMALMIRHSDNGQSQNKINLLKKLLNIIVGVLHMDHEVRKQDFNAMPYHRILISLFNEITGPDPLKLLEPIAWSILEAFGQTFFALQPRRMPGFAFAWLDIVGHRNVIGRLLANTGIAETVDAVKTAATYTQLIISHLKFLAPFLRNIQLPKSIAILYKGTLRVLLVILHDFPELLCEFHYVICDTIPPNCVQLRNLILSAYPRQMRLPDPFALNFKQVDTIPEMAVEPKSNLNMATIIPDNIRIPLDEYLANRISVDFLPNLPTLLQTQNQAGTKYNTTVMNALVLYVGIRAIEHLHLRRQRISTLNIAHTSYMDIFQNLAIQLDTEGRYLLFNGIANQLRYPNAHTHYFSCVFLYLFKNSTNDTIQEQITRILFERLVALRPHPWGLLITFIELIKNPTYNFWRYEFTSCAPEIQRLFQNVANTCVPAQGSQPQAQPDGAPGPLGNNTGAANQQQNPNTN |
Proteomic databases
Expression
Tissue specificity
Highly expressed in the germline of hermaphrodites.
Developmental stage
Highly expressed in embryos.
Gene expression databases
Interaction
Subunit
Component of the CCR4-NOT complex at least composed of ccf-1, ccr-4 and let-711, which is required for germ cell development in hermaphrodites (PubMed:23843623).
Within the complex interacts with ccf-1 and ccr-4; the interactions are direct (PubMed:23843623).
Within the complex interacts with ccf-1 and ccr-4; the interactions are direct (PubMed:23843623).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for motif, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 660-664 | LXXLL | ||||
Sequence: LSELL | ||||||
Compositional bias | 771-850 | Polar residues | ||||
Sequence: SGRSSSVSSGGHVQQSSGSQPQQQQFGGGSGLPPSGVVPVQQQPQQPPSLQQQHSQQSLPTPPTTSQQQIHVQQSVPGPI | ||||||
Region | 771-887 | Disordered | ||||
Sequence: SGRSSSVSSGGHVQQSSGSQPQQQQFGGGSGLPPSGVVPVQQQPQQPPSLQQQHSQQSLPTPPTTSQQQIHVQQSVPGPIQRPAQFAPQPMFPPQAQAQHQHQHMMGQPPPSSQNAQ | ||||||
Compositional bias | 862-887 | Polar residues | ||||
Sequence: FPPQAQAQHQHQHMMGQPPPSSQNAQ | ||||||
Region | 936-963 | Disordered | ||||
Sequence: TQRQNSNSGWHAAPAPQRPSGPPTPQQQ | ||||||
Region | 1197-1221 | Disordered | ||||
Sequence: EGGRHTPVGSAQAGSASSTPTPAAA | ||||||
Compositional bias | 1206-1221 | Polar residues | ||||
Sequence: SAQAGSASSTPTPAAA | ||||||
Region | 1518-1565 | Disordered | ||||
Sequence: QSKIHMSGSAEQLSGMSPAIPDQVKPATPQPTEAELQSGTGGGGSQGA | ||||||
Compositional bias | 1519-1533 | Polar residues | ||||
Sequence: SKIHMSGSAEQLSGM | ||||||
Compositional bias | 1547-1562 | Polar residues | ||||
Sequence: QPTEAELQSGTGGGGS | ||||||
Region | 2034-2054 | Disordered | ||||
Sequence: GMNNAMNNGAGNAAHHHAGLQ | ||||||
Motif | 2341-2345 | LXXLL | ||||
Sequence: LRVLL | ||||||
Region | 2609-2641 | Disordered | ||||
Sequence: AQGSQPQAQPDGAPGPLGNNTGAANQQQNPNTN | ||||||
Compositional bias | 2627-2641 | Polar residues | ||||
Sequence: NNTGAANQQQNPNTN |
Domain
Contains Leu-Xaa-Xaa-Leu-Leu (LXXLL) motifs, a motif known to be important for the association with nuclear receptors.
Sequence similarities
Belongs to the CNOT1 family.
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 5 isoforms produced by Alternative splicing.
Q20937-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Namea
- SynonymsNTL-1a
- Length2,641
- Mass (Da)295,080
- Last updated2013-02-06 v3
- ChecksumF7A359E893C846F8
Q20937-2
- Nameb
- Differences from canonical
- 1-17: Missing
Q20937-3
- Namec
- Differences from canonical
- 1-307: Missing
Q20937-4
- Named
- SynonymsNTL-1b
- Differences from canonical
- 1-766: Missing
Q20937-5
- Namee
- Differences from canonical
- 1-2384: Missing
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_061213 | 1-17 | in isoform b | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_061212 | 1-307 | in isoform c | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_061211 | 1-766 | in isoform d | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_061210 | 1-2384 | in isoform e | |||
Sequence: Missing | ||||||
Compositional bias | 771-850 | Polar residues | ||||
Sequence: SGRSSSVSSGGHVQQSSGSQPQQQQFGGGSGLPPSGVVPVQQQPQQPPSLQQQHSQQSLPTPPTTSQQQIHVQQSVPGPI | ||||||
Compositional bias | 862-887 | Polar residues | ||||
Sequence: FPPQAQAQHQHQHMMGQPPPSSQNAQ | ||||||
Compositional bias | 1206-1221 | Polar residues | ||||
Sequence: SAQAGSASSTPTPAAA | ||||||
Compositional bias | 1519-1533 | Polar residues | ||||
Sequence: SKIHMSGSAEQLSGM | ||||||
Compositional bias | 1547-1562 | Polar residues | ||||
Sequence: QPTEAELQSGTGGGGS | ||||||
Compositional bias | 2627-2641 | Polar residues | ||||
Sequence: NNTGAANQQQNPNTN |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
KC964869 EMBL· GenBank· DDBJ | AGT18674.1 EMBL· GenBank· DDBJ | mRNA | ||
KC964870 EMBL· GenBank· DDBJ | AGT18675.1 EMBL· GenBank· DDBJ | mRNA | ||
BX284603 EMBL· GenBank· DDBJ | CCD70321.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX284603 EMBL· GenBank· DDBJ | SCN13882.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX284603 EMBL· GenBank· DDBJ | SCN13883.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX284603 EMBL· GenBank· DDBJ | SCN13884.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX284603 EMBL· GenBank· DDBJ | SCN13885.1 EMBL· GenBank· DDBJ | Genomic DNA |