Q20053 · AT5F1_CAEEL

  • Protein
    ATP synthase F(0) complex subunit B1, mitochondrial
  • Gene
    asb-1
  • Status
    UniProtKB reviewed (Swiss-Prot)
  • Amino acids
  • Protein existence
    Evidence at transcript level
  • Annotation score
    4/5

Function

function

Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core, and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain and the peripheric stalk, which acts as a stator to hold the subunits of the catalytic subcomplexes relative to the rotary elements (Probable). Plays a role in germline development (PubMed:17223323).

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentmitochondrial inner membrane
Cellular Componentmitochondrion
Cellular Componentnon-motile cilium
Cellular Componentproton-transporting ATP synthase complex, coupling factor F(o)
Molecular Functionproton transmembrane transporter activity
Biological Processproton motive force-driven ATP synthesis

Keywords

Enzyme and pathway databases

Names & Taxonomy

Protein names

  • Recommended name
    ATP synthase F(0) complex subunit B1, mitochondrial
  • Alternative names
    • ATP synthase peripheral stalk-membrane subunit B1
    • ATP synthase proton-transporting mitochondrial F(0) complex subunit B1
    • ATP synthase subunit B1
      (ATPase subunit B1
      )

Gene names

    • Name
      asb-1
    • ORF names
      F35G12.10

Organism names

  • Taxonomic identifier
  • Organism
  • Strain
    • Bristol N2
  • Taxonomic lineage
    Eukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis

Accessions

  • Primary accession
    Q20053

Proteomes

Organism-specific databases

Phenotypes & Variants

Disruption phenotype

RNAi-mediated knockdown results in sterility (PubMed:17223323).
RNAi-mediated knockdown does not affect the timing of hypodermal and vulval development (PubMed:17223323).

PTM/Processing

Features

Showing features for transit peptide, chain.

TypeIDPosition(s)Description
Transit peptide1-21Mitochondrion
ChainPRO_000045458822-301ATP synthase F0 complex subunit B1, mitochondrial

Proteomic databases

Expression

Developmental stage

Specifically expressed in the germline from the L1 larval stage.

Gene expression databases

Interaction

Subunit

Subunit of the F-type ATPase which has 2 components, CF1 - the catalytic core - and CF0 - the membrane proton channel.

Protein-protein interaction databases

Structure

Family & Domains

Sequence similarities

Belongs to the eukaryotic ATPase B chain family.

Keywords

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Sequence processing
    The displayed sequence is further processed into a mature form.
  • Length
    301
  • Mass (Da)
    34,368
  • Last updated
    1996-11-01 v1
  • Checksum
    DADDF5C4C020221B
MSLSRLSSPQTFSRVFIVARGAATGHAVAPSSDNSIGYFEKIAYRFKGIPLPTETEAPKSMFDACNKEWSAPELLPSVPKDFKEHPDRDLTNYPYPSRPMYPPKTRLLMMPDSWFTAFQKVTGTSGPYLFFGGLFAFLVNKELWVFEEQGHMTVGWILFYLLVSRTAGYKIDAGLYKDYQERVGFFKGLIQEDLKEAVDFRKTSAAQTASFAALKEGMPTSLKDSMQLQLEAAYRKNVQTISNEIKRRIEYLKETEETKARFERDQLLKLINDSVEKQVSQKDFQEKFLQNAIQQLKGIAV

Keywords

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
BX284603
EMBL· GenBank· DDBJ
CAA86329.1
EMBL· GenBank· DDBJ
Genomic DNA

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp