Q1PF08 · SCP22_ARATH
- ProteinSerine carboxypeptidase-like 22
- GeneSCPL22
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids464 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Probable carboxypeptidase.
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 179 | |||||
Sequence: S | ||||||
Active site | 385 | |||||
Sequence: D | ||||||
Active site | 437 | |||||
Sequence: H |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | serine-type carboxypeptidase activity | |
Biological Process | proteolysis |
Keywords
- Molecular function
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameSerine carboxypeptidase-like 22
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ1PF08
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MARTHLLFLLFVLLSLATSSTS | ||||||
Chain | PRO_0000274638 | 23-464 | Serine carboxypeptidase-like 22 | |||
Sequence: TKEQEEDRIKALPGQPKVGFSQFSGYVTVNESHGRSLFYWLTESSSHSPHTKPLLLWLNGGPGCSSIAYGASEEIGPFRISKTGCNLYLNNFSWNTEANLLFLESPVGVGFSYTNTSSDFEESGDERTAQENLIFLISWMSRFPQYRYRDFYIVGESYAGHYVPQLAQKIHEYNNAYKNPVINLKGFMVGNPEMDKNNDRLGTITYWWSHAMISDASYNRILKNCDFTADRFSKECDSAIYVAAADFGDIDQYSIYTPKCVPPQDQTNQTKFEQMMQMHTTKRFLEDQYDPCTENYAEIYYNRPEVQRAMHANHTAIPYKWTACSDSVFNNWNWRDSDNSMLPIYKELIAAGLRIWVYSGDTDSVIPVTATRYSLGKLNLRVKTRWYPWYSGNQVGGRTEVYEGLTFVTVRGAGHEVPFFQPQSALILLRSFLAGNELSRSY | ||||||
Glycosylation | 52 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 86↔346 | |||||
Sequence: CSSIAYGASEEIGPFRISKTGCNLYLNNFSWNTEANLLFLESPVGVGFSYTNTSSDFEESGDERTAQENLIFLISWMSRFPQYRYRDFYIVGESYAGHYVPQLAQKIHEYNNAYKNPVINLKGFMVGNPEMDKNNDRLGTITYWWSHAMISDASYNRILKNCDFTADRFSKECDSAIYVAAADFGDIDQYSIYTPKCVPPQDQTNQTKFEQMMQMHTTKRFLEDQYDPCTENYAEIYYNRPEVQRAMHANHTAIPYKWTAC | ||||||
Glycosylation | 113 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 137 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 247↔258 | |||||
Sequence: CDFTADRFSKEC | ||||||
Disulfide bond | 282↔314 | |||||
Sequence: CVPPQDQTNQTKFEQMMQMHTTKRFLEDQYDPC | ||||||
Glycosylation | 290 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 335 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Protein-protein interaction databases
Structure
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
Q1PF08-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length464
- Mass (Da)53,106
- Last updated2006-05-16 v1
- ChecksumDFACB79F8A5BE6E4
Q1PF08-2
- Name2
- Differences from canonical
- 119-181: Missing
Sequence caution
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_022849 | 119-181 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC005170 EMBL· GenBank· DDBJ | AAC63668.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002685 EMBL· GenBank· DDBJ | AEC07515.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC07516.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DQ446557 EMBL· GenBank· DDBJ | ABE65855.1 EMBL· GenBank· DDBJ | mRNA | ||
DQ446558 EMBL· GenBank· DDBJ | ABE65856.1 EMBL· GenBank· DDBJ | mRNA |