Q1PE15 · MCU4_ARATH
- ProteinCalcium uniporter protein 4, mitochondrial
- GeneMCU4
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids338 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Mitochondrial inner membrane calcium uniporter that mediates calcium uptake into mitochondria (By similarity).
Constitutes a pore-forming and calcium-conducting subunit (By similarity).
Mitochondrial calcium homeostasis plays key roles in cellular physiology and regulates cell bioenergetics, cytoplasmic calcium signals and activation of cell death pathways (By similarity).
Constitutes a pore-forming and calcium-conducting subunit (By similarity).
Mitochondrial calcium homeostasis plays key roles in cellular physiology and regulates cell bioenergetics, cytoplasmic calcium signals and activation of cell death pathways (By similarity).
Catalytic activity
- Ca2+(in) = Ca2+(out)
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Cellular Component | mitochondrion | |
Molecular Function | calcium channel activity | |
Molecular Function | metal ion binding | |
Biological Process | mitochondrial calcium ion homeostasis |
Keywords
- Molecular function
- Biological process
- Ligand
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameCalcium uniporter protein 4, mitochondrial
- Short namesAtMCU4
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ1PE15
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 233-253 | Helical; Name=1 | ||||
Sequence: LWAGLGYLIIQTAGFMRLTFW | ||||||
Transmembrane | 263-280 | Helical; Name=2 | ||||
Sequence: ICFYVSSVYFMAGYTFFL |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-36 | Mitochondrion | ||||
Sequence: MVMMKKLLSNRLFNMSKTASQSLMNCRTSSSSSLAM | ||||||
Chain | PRO_0000431370 | 37-338 | Calcium uniporter protein 4, mitochondrial | |||
Sequence: RTRVPKDIGEATIDPEPGDLTISQRFLNKFSMNGIDTTSKMSIGESLMEKLKEMDMNKDRIRLDGLSHPKEETLGLTVQDVKKLLRAAEIEVIKTKLMETGKIWIRYSDFLGVCSDSSLDPSQGALIAKMLDDSGNVIVMGNSVCLRPHQLTKSIEGLLPLSQIHNPNDPRRKELNELEAIKTVIDQKAHSLVRRELWAGLGYLIIQTAGFMRLTFWDLTWDVMEPICFYVSSVYFMAGYTFFLKTSREPSFQGFYQSRFEAKQRKLMQSEDFDVGRYDELKKLFNPKPSGAVPKILGSLQN |
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 257-265 | Selectivity filter | ||||
Sequence: WDVMEPICF |
Sequence similarities
Belongs to the MCU (TC 1.A.77) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length338
- Mass (Da)38,349
- Last updated2006-05-16 v1
- Checksum5DE85990FC0D3C04
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Z99708 EMBL· GenBank· DDBJ | CAB16819.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AL161590 EMBL· GenBank· DDBJ | CAB80348.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002687 EMBL· GenBank· DDBJ | AEE86706.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DQ446903 EMBL· GenBank· DDBJ | ABE66118.1 EMBL· GenBank· DDBJ | mRNA | ||
DQ653251 EMBL· GenBank· DDBJ | ABK28670.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. |