Q1MTB5 · Q1MTB5_DANRE
- ProteinHedgehog protein
- Geneshha
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids418 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
The C-terminal part of the sonic hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity. Both activities result in the cleavage of the full-length protein into two parts (ShhN and ShhC) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated ShhN. Both activities occur in the reticulum endoplasmic. Once cleaved, ShhC is degraded in the endoplasmic reticulum.
Protein hedgehog N-product
The dually lipidated hedgehog protein N-product is a morphogen which is essential for a variety of patterning events during development.
Protein hedgehog
The C-terminal part of the hedgehog protein precursor displays an autoproteolysis activity that results in the cleavage of the full-length protein into two parts (N-product and C-product). In addition, the C-terminal part displays a cholesterol transferase activity that results by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product.
Catalytic activity
- glycyl-L-cysteinyl-[protein] + cholesterol + H+ = [protein]-C-terminal glycyl cholesterol ester + N-terminal L-cysteinyl-[protein]This reaction proceeds in the forward direction.
Features
Showing features for binding site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 89 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 90 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 90 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 95 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 125 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 126 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 126 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 129 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 131 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 140 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 147 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 182 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Site | 197-198 | Cleavage; by autolysis | ||||
Sequence: GC | ||||||
Site | 243 | Involved in cholesterol transfer | ||||
Sequence: D | ||||||
Site | 267 | Involved in auto-cleavage | ||||
Sequence: T | ||||||
Site | 270 | Essential for auto-cleavage | ||||
Sequence: H |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | Golgi membrane | |
Cellular Component | plasma membrane | |
Molecular Function | metal ion binding | |
Molecular Function | peptidase activity | |
Molecular Function | transferase activity | |
Biological Process | animal organ development | |
Biological Process | cell development | |
Biological Process | cell fate commitment | |
Biological Process | cell-cell signaling | |
Biological Process | central nervous system development | |
Biological Process | intein-mediated protein splicing | |
Biological Process | neuron differentiation | |
Biological Process | pattern specification process | |
Biological Process | protein autoprocessing | |
Biological Process | regulation of cell population proliferation | |
Biological Process | regulation of developmental process | |
Biological Process | tissue development | |
Biological Process | tube development |
Keywords
- Molecular function
- Ligand
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameHedgehog protein
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionQ1MTB5
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-23 | |||||
Sequence: MRLLTRVLLVSLLTLSLVVSGLA | ||||||
Chain | PRO_5010136573 | 24-418 | Hedgehog protein | |||
Sequence: CGPGRGYGRRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNSLAISVMNHWPGVKLRVTEGWDEDGHHFEESLHYEGRAVDITTSDRDKSKYGTLSRLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGCFPGSALVSLQDGGQKAVKDLNPGDKVLAADSAGNLVFSDFIMFTDRDSTTRRVFYVIETQEPVEKITLTAAHLLFVLDNSTEDLHTMTAAYASSVRAGQKVMVVDDSGQLKSVIVQRIYTEEQRGSFAPVTAHGTIVVDRILASCYAVIEDQGLAHLAFAPARLYYYVSSFLFPQNSSSRSNATLQQEGVHWYSRLLYQMGTWLLDSNMLHPLGMSVNSS |
Keywords
- PTM
Interaction
Subunit
Multimer.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 196-303 | Hint | ||||
Sequence: GGCFPGSALVSLQDGGQKAVKDLNPGDKVLAADSAGNLVFSDFIMFTDRDSTTRRVFYVIETQEPVEKITLTAAHLLFVLDNSTEDLHTMTAAYASSVRAGQKVMVVD | ||||||
Domain | 305-349 | Hint | ||||
Sequence: SGQLKSVIVQRIYTEEQRGSFAPVTAHGTIVVDRILASCYAVIED |
Sequence similarities
Belongs to the hedgehog family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length418
- Mass (Da)46,403
- Last updated2006-05-30 v1
- ChecksumCF000AFFFD2F5795
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC162395 EMBL· GenBank· DDBJ | AAI62395.1 EMBL· GenBank· DDBJ | mRNA | ||
AL929206 EMBL· GenBank· DDBJ | CAK04143.1 EMBL· GenBank· DDBJ | Genomic DNA |