Q1LX51 · WEE2_DANRE
- ProteinWee1-like protein kinase 2
- Genewee2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids532 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Oocyte-specific protein tyrosine kinase that phosphorylates and inhibits cdk1 and acts as a key regulator of meiosis. Required to maintain meiotic arrest in oocytes by phosphorylating cdk1 at 'Tyr-15', leading to inhibit cdk1 activity and prevent meiotic reentry (By similarity).
Catalytic activity
- ATP + L-tyrosyl-[protein] = ADP + H+ + O-phospho-L-tyrosyl-[protein]
Features
Showing features for binding site, active site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | ATP binding | |
Molecular Function | magnesium ion binding | |
Molecular Function | non-membrane spanning protein tyrosine kinase activity | |
Molecular Function | protein tyrosine kinase activity | |
Biological Process | meiotic cell cycle | |
Biological Process | mitotic cell cycle | |
Biological Process | regulation of meiosis I |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameWee1-like protein kinase 2
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionQ1LX51
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000409528 | 1-532 | Wee1-like protein kinase 2 | |||
Sequence: MKWSEMASVNATQQHLNFSSSWEEDSSDNSFDEWTHKSVPLRSPCRTPRIQRHRNRSITVSPSVPTSPIPYAAWKKLRLCDSPSTPKSLLSKSTMPCSSSKTCRSQRFLRLSTAFERVPSVNINPFTPDTVRRNSEHYKRKSQRSDDDEDYGPRSKEIQNSSEDESFFLPSKRPAVSARMLSRYESEFLELACIGVGEFGSVYRCVKRLDGCMYAIKRSRRPIAGSANEQLALKEVYAHAVLGHHPHVVRYYSAWAEDDHMIIQNEYCDGGSLHDAITEKREQGEFFSVPELRDLLLQVSMGLKYIHNSGLVHLDIKPSNIFICRRSTLSAGGEGDSEEEDESHSSGVVYKIGDLGHVTSISSPQVEEGDSRFLAYEVLREDYTHLPKADIFALGLTVLLAAGASPLPQNGDDWHRLRQGELPNLPHELPALFKDLLKSLLDPDPTARPSATALCRHDVLCKERAGKLATQLRKELNVEKFRTAMLERELKEARLAATSPQQSCQPGSLPKAKRKLVGRNVARSVSFGFPGY |
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 123-166 | Disordered | ||||
Sequence: INPFTPDTVRRNSEHYKRKSQRSDDDEDYGPRSKEIQNSSEDES | ||||||
Compositional bias | 132-161 | Basic and acidic residues | ||||
Sequence: RRNSEHYKRKSQRSDDDEDYGPRSKEIQNS | ||||||
Domain | 188-465 | Protein kinase | ||||
Sequence: FLELACIGVGEFGSVYRCVKRLDGCMYAIKRSRRPIAGSANEQLALKEVYAHAVLGHHPHVVRYYSAWAEDDHMIIQNEYCDGGSLHDAITEKREQGEFFSVPELRDLLLQVSMGLKYIHNSGLVHLDIKPSNIFICRRSTLSAGGEGDSEEEDESHSSGVVYKIGDLGHVTSISSPQVEEGDSRFLAYEVLREDYTHLPKADIFALGLTVLLAAGASPLPQNGDDWHRLRQGELPNLPHELPALFKDLLKSLLDPDPTARPSATALCRHDVLCKERA | ||||||
Coiled coil | 469-495 | |||||
Sequence: ATQLRKELNVEKFRTAMLERELKEARL |
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q1LX51-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length532
- Mass (Da)59,774
- Last updated2011-05-31 v2
- Checksum2192E4A0F6113D3C
Q1LX51-2
- Name2
- Differences from canonical
- 1-5: Missing
Features
Showing features for alternative sequence, sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_041325 | 1-5 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 17 | in Ref. 2; AAI08039 | ||||
Sequence: N → S | ||||||
Sequence conflict | 37 | in Ref. 2; AAI34854 | ||||
Sequence: K → R | ||||||
Sequence conflict | 102 | in Ref. 2; AAI08039/AAI34854 | ||||
Sequence: T → P | ||||||
Compositional bias | 132-161 | Basic and acidic residues | ||||
Sequence: RRNSEHYKRKSQRSDDDEDYGPRSKEIQNS | ||||||
Sequence conflict | 424 | in Ref. 2; AAI08039/AAI34854 | ||||
Sequence: N → S | ||||||
Sequence conflict | 461 | in Ref. 2; AAI08039 | ||||
Sequence: C → R |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX470166 EMBL· GenBank· DDBJ | CAK04661.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX470166 EMBL· GenBank· DDBJ | CAK04662.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC108038 EMBL· GenBank· DDBJ | AAI08039.1 EMBL· GenBank· DDBJ | mRNA | ||
BC134853 EMBL· GenBank· DDBJ | AAI34854.1 EMBL· GenBank· DDBJ | mRNA |