Q1LVI2 · YJEN3_DANRE
- ProteinYjeF N-terminal domain-containing 3
- Geneyjefn3
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids246 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Accelerates cholesterol efflux from endothelial cells to high-density lipoprotein (HDL) and thereby regulates angiogenesis (PubMed:23719382).
Orchestrates hematopoietic stem and progenitor cell emergence from the hemogenic endothelium, a type of specialized endothelium manifesting hematopoietic potential. YJEFN3-mediated cholesterol efflux activates endothelial SREBF2, the master transcription factor for cholesterol biosynthesis, which in turn transactivates NOTCH and promotes hematopoietic stem and progenitor cell emergence (PubMed:30705153).
Orchestrates hematopoietic stem and progenitor cell emergence from the hemogenic endothelium, a type of specialized endothelium manifesting hematopoietic potential. YJEFN3-mediated cholesterol efflux activates endothelial SREBF2, the master transcription factor for cholesterol biosynthesis, which in turn transactivates NOTCH and promotes hematopoietic stem and progenitor cell emergence (PubMed:30705153).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | NADHX epimerase activity | |
Biological Process | hematopoietic stem cell proliferation | |
Biological Process | lipid transport | |
Biological Process | membrane raft distribution | |
Biological Process | negative regulation of angiogenesis | |
Biological Process | regulation of cholesterol efflux | |
Biological Process | regulation of Notch signaling pathway | |
Biological Process | sprouting angiogenesis |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameYjeF N-terminal domain-containing 3
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionQ1LVI2
Proteomes
Organism-specific databases
Phenotypes & Variants
Disruption phenotype
Morpholino knockdowns have a reduced number of nascent hematopoietic stem cells in the ventral dorsal aorta between 28 and 60 hours post-fertilization (hpf) (PubMed:23719382, PubMed:30705153).
Morpholino knockdowns show increased levels of free (unesterified) cholesterol (PubMed:23719382, PubMed:30705153).
Morpholino knockdowns show increased levels of free (unesterified) cholesterol (PubMed:23719382, PubMed:30705153).
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000450455 | 1-246 | YjeF N-terminal domain-containing 3 | |||
Sequence: MNHSSNEKEPETIEPLRYLSKTEVATVETELLRDYRFGQQQLIEIWGHACAIAITKAFPLSSLSKKQPTLLVVCGPEQNGSIGLVCARHLRMFEYEPTIFYPKRSTLGLHQDFTVQCEKMDIPFLSYLPTEVQLLNDAYNLVIDAILGPETDHKDVKEPYAGMLVTLKQVKIPIVSVDVPSGWDADEPAKDGINPEVLISLTAPKKCATGFSGKHFLAGRFLPYDIQKKYELNLPEFPGTECIIEL |
Proteomic databases
Expression
Developmental stage
Expression in 24-36 hours post-fertilization (hpf) embryos shows a clear segmental pattern. By 48 hpf, when segmental angiogenesis is completed, is no longer expressed in somites.
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 24-234 | YjeF N-terminal | ||||
Sequence: VATVETELLRDYRFGQQQLIEIWGHACAIAITKAFPLSSLSKKQPTLLVVCGPEQNGSIGLVCARHLRMFEYEPTIFYPKRSTLGLHQDFTVQCEKMDIPFLSYLPTEVQLLNDAYNLVIDAILGPETDHKDVKEPYAGMLVTLKQVKIPIVSVDVPSGWDADEPAKDGINPEVLISLTAPKKCATGFSGKHFLAGRFLPYDIQKKYELNL |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length246
- Mass (Da)27,609
- Last updated2006-05-30 v1
- ChecksumAD6F399AAB25EE3D
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX649279 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BX664610 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |