Q1HMQ7 · Q1HMQ7_TOBAC
- ProteinTubulin gamma chain
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids464 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Tubulin is the major constituent of microtubules. The gamma chain is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome.
Tubulin is the major constituent of microtubules. The gamma chain is found at microtubule organizing centers (MTOC) such as the spindle poles, suggesting that it is involved in the minus-end nucleation of microtubule assembly.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | gamma-tubulin complex | |
Cellular Component | microtubule | |
Cellular Component | nucleus | |
Cellular Component | spindle | |
Molecular Function | GTP binding | |
Molecular Function | structural constituent of cytoskeleton | |
Biological Process | cytoplasmic microtubule organization | |
Biological Process | meiotic spindle organization | |
Biological Process | microtubule nucleation | |
Biological Process | mitotic sister chromatid segregation | |
Biological Process | mitotic spindle organization |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended nameTubulin gamma chain
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > asterids > lamiids > Solanales > Solanaceae > Nicotianoideae > Nicotianeae > Nicotiana
Accessions
- Primary accessionQ1HMQ7
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 38-237 | Tubulin/FtsZ GTPase | ||||
Sequence: KDVFFYQADDQHYIPRALLMDLEPRVINGIQNGEYRNLYNHENVFIADHGGGAGNNWASGYHQGKQYEEDLMDMIDREADGSDSLEGFVLCHSIAGGTGSGMGSYILETLNDRYSKKLVQTYSVFPNQNETSDVVVQPYNSLLTLKRLTLNADCVVVLDNTALNRIAVERLHITTPTFAQTNSLVSTVMSASTTTLRYPG | ||||||
Domain | 239-385 | Tubulin/FtsZ 2-layer sandwich | ||||
Sequence: MNNDLVGLLASLIPTPRCHFLMTGYTPLTVERQANVIRKTTVLDVMRRLLQTKNIMVSSYARTKEASQAKYISILNIIQGEVDPTQVHESLQRIRERKLVNFIDWGPASIQVALSRKSPYVQTAHRVSGLMLASHTGIRHLFSKCLS |
Sequence similarities
Belongs to the tubulin family.
Family and domain databases
Sequence
- Sequence statusFragment
- Length464
- Mass (Da)52,137
- Last updated2006-06-13 v1
- Checksum59D89B298DE8432C
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: G |