Q1H5H1 · SELT_RAT
- ProteinThioredoxin reductase-like selenoprotein T
- GeneSelenot
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids195 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Selenoprotein with thioredoxin reductase-like oxidoreductase activity (PubMed:26866473).
Protects dopaminergic neurons against oxidative stress and cell death (By similarity).
Involved in ADCYAP1/PACAP-induced calcium mobilization and neuroendocrine secretion (PubMed:18198219).
Plays a role in fibroblast anchorage and redox regulation (By similarity).
In gastric smooth muscle, modulates the contraction processes through the regulation of calcium release and MYLK activation (PubMed:26779623).
In pancreatic islets, involved in the control of glucose homeostasis, contributes to prolonged ADCYAP1/PACAP-induced insulin secretion (By similarity).
Protects dopaminergic neurons against oxidative stress and cell death (By similarity).
Involved in ADCYAP1/PACAP-induced calcium mobilization and neuroendocrine secretion (PubMed:18198219).
Plays a role in fibroblast anchorage and redox regulation (By similarity).
In gastric smooth muscle, modulates the contraction processes through the regulation of calcium release and MYLK activation (PubMed:26779623).
In pancreatic islets, involved in the control of glucose homeostasis, contributes to prolonged ADCYAP1/PACAP-induced insulin secretion (By similarity).
Catalytic activity
- [thioredoxin]-dithiol + NADP+ = [thioredoxin]-disulfide + H+ + NADPH
RHEA-COMP:10698 CHEBI:29950 Position: nCHEBI:29950 Position: n+3+ CHEBI:58349 = RHEA-COMP:10700 CHEBI:50058 Position: n/n+3+ CHEBI:15378 + CHEBI:57783
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum | |
Cellular Component | endoplasmic reticulum membrane | |
Molecular Function | thioredoxin-disulfide reductase (NADPH) activity | |
Biological Process | cell redox homeostasis | |
Biological Process | cellular oxidant detoxification | |
Biological Process | glucose homeostasis | |
Biological Process | insulin secretion involved in cellular response to glucose stimulus | |
Biological Process | pancreas development | |
Biological Process | positive regulation of cytosolic calcium ion concentration | |
Biological Process | positive regulation of growth hormone secretion | |
Biological Process | response to glucose |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameThioredoxin reductase-like selenoprotein T
- EC number
- Short namesSelT
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionQ1H5H1
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Single-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 85-103 | Helical | ||||
Sequence: IASFLSVFKLVLIGLIIVG |
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 46-49 | Highly reduces thioredoxin reductase activity. | ||||
Sequence: CVSU → SVSS | ||||||
Mutagenesis | 49 | Abolishes regulation of calcium mobilization. | ||||
Sequence: U → A |
PTM/Processing
Features
Showing features for signal, chain, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-19 | |||||
Sequence: MRLLLLLLVAASAVVRSEA | ||||||
Chain | PRO_0000252038 | 20-195 | Thioredoxin reductase-like selenoprotein T | |||
Sequence: SANLGGVPSKRLKMQYATGPLLKFQICVSUGYRRVFEEYMRVISQRYPDIRIEGENYLPQPIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQWGQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS | ||||||
Cross-link | 46↔49 | Cysteinyl-selenocysteine (Cys-Sec) | ||||
Sequence: CVSU |
Post-translational modification
May contain a selenide-sulfide bond between Cys-46 and Sec-49. This bond is speculated to serve as redox-active pair (By similarity).
Proteomic databases
PTM databases
Expression
Tissue specificity
Ubiquitous, detected in all tissues tested.
Induction
Rapidly induced by ADCYAP1/PACAP neuropeptide and cAMP.
Developmental stage
Ubiquitously expressed as early as 7 dpc.
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Sequence similarities
Belongs to the SelWTH family. Selenoprotein T subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length195
- Mass (Da)22,292
- Last updated2008-02-26 v2
- Checksum4F2602FA6C1ABE96
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
F8WFN1 | F8WFN1_RAT | Selenot | 194 |
Features
Showing features for non-standard residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-standard residue | 49 | Selenocysteine | ||||
Sequence: U |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY995234 EMBL· GenBank· DDBJ | AAY45888.1 EMBL· GenBank· DDBJ | mRNA |