Q1G3E7 · SOP23_ARATH
- ProteinSerine rich endogenous peptide 23
- GenePROSCOOP23
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Brassicaceae-specific phytocytokine (plant endogenous peptide released into the apoplast) perceived by MIK2 in a BAK1/SERK3 and SERK4 coreceptors-dependent manner, that modulates various physiological and antimicrobial processes including growth prevention and reactive oxygen species (ROS) response regulation (PubMed:34535661).
Inhibits root growth (PubMed:34535661).
Inhibits root growth (PubMed:34535661).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | apoplast | |
Cellular Component | plasma membrane | |
Molecular Function | LRR domain binding | |
Molecular Function | receptor serine/threonine kinase binding |
Names & Taxonomy
Protein names
- Recommended nameSerine rich endogenous peptide 23
- Short namesAtSCOOP23
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ1G3E7
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: The precursor of SCOOP23, PROSCOOP23, accumulates at the plasma membrane and is proteolytically cleaved to release the SCOOP23 in the apoplasm.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for peptide, signal, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Peptide | PRO_0000457259 | ?-74 | Serine rich endogenous peptide 23 | |||
Sequence: MNKVVVYVLALSILLFFGLPNTTLARVQYGSPVSRKEIGKGVWDQKVFNEIKIAVGGSDSVRAHSKDHKSNPNG | ||||||
Signal | 1-25 | |||||
Sequence: MNKVVVYVLALSILLFFGLPNTTLA | ||||||
Propeptide | PRO_0000457258 | 26-? | Removed in mature form | |||
Sequence: MNKVVVYVLALSILLFFGLPNTTLA |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Mostly expressed in roots, and, to a lower extent, in seedlings shoots.
Gene expression databases
Interaction
Subunit
Interacts with MIK2 (via extracellular leucine-rich repeat domain); this interaction triggers the formation of complex between MIK2 and the BAK1/SERK3 and SERK4 coreceptors, and subsequent BAK1 activation by phosphorylation.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 52-66 | SCOOP motif | ||||
Sequence: KIAVGGSDSVRAHSK | ||||||
Motif | 58-60 | SxS motif essential for MIK2 binding | ||||
Sequence: SDS |
Sequence similarities
Belongs to the serine rich endogenous peptide (SCOOP) phytocytokine family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length74
- Mass (Da)8,083
- Last updated2006-06-27 v1
- Checksum223A7774C281A86C
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC025782 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CP002684 EMBL· GenBank· DDBJ | AEE31868.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DQ487637 EMBL· GenBank· DDBJ | ABF59257.1 EMBL· GenBank· DDBJ | mRNA | ||
DQ652731 EMBL· GenBank· DDBJ | ABK28353.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. |