Q1DHR3 · NACA_COCIM
- ProteinNascent polypeptide-associated complex subunit alpha
- GeneEGD2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids205 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nascent polypeptide-associated complex | |
Cellular Component | nucleus | |
Molecular Function | unfolded protein binding | |
Biological Process | protein targeting to membrane | |
Biological Process | protein transport |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameNascent polypeptide-associated complex subunit alpha
- Short namesNAC-alpha
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Eurotiomycetes > Eurotiomycetidae > Onygenales > Onygenaceae > Coccidioides
Accessions
- Primary accessionQ1DHR3
- Secondary accessions
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000273486 | 1-205 | Nascent polypeptide-associated complex subunit alpha | |||
Sequence: MANPRVEELPDEEVPKTTVEDAGESSESEAEAAEEPTIPGGAAITVHSRNEKKARKAIGKLGLKHVPGITRVTLRRPKNILFVINQPDVYRSPSSNTWIIFGEAKIEDLNSQAQASAAQQLSAAEAAGNGEHAGHEHIDLGKGKAPETEKKEEEEEEEGEVDETGLEAKDIELVMAQANVSRSKAIKALKENDNDIVNSIMALSV |
Interaction
Subunit
Part of the nascent polypeptide-associated complex (NAC), consisting of EGD2 and EGD1. NAC associates with ribosomes via EGD1 (By similarity).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-23 | Basic and acidic residues | ||||
Sequence: MANPRVEELPDEEVPKTTVEDAG | ||||||
Region | 1-42 | Disordered | ||||
Sequence: MANPRVEELPDEEVPKTTVEDAGESSESEAEAAEEPTIPGGA | ||||||
Domain | 48-113 | NAC-A/B | ||||
Sequence: SRNEKKARKAIGKLGLKHVPGITRVTLRRPKNILFVINQPDVYRSPSSNTWIIFGEAKIEDLNSQA | ||||||
Region | 120-169 | Disordered | ||||
Sequence: QLSAAEAAGNGEHAGHEHIDLGKGKAPETEKKEEEEEEEGEVDETGLEAK | ||||||
Compositional bias | 130-150 | Basic and acidic residues | ||||
Sequence: GEHAGHEHIDLGKGKAPETEK | ||||||
Compositional bias | 151-165 | Acidic residues | ||||
Sequence: KEEEEEEEGEVDETG | ||||||
Domain | 166-205 | UBA | ||||
Sequence: LEAKDIELVMAQANVSRSKAIKALKENDNDIVNSIMALSV |
Sequence similarities
Belongs to the NAC-alpha family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length205
- Mass (Da)22,081
- Last updated2006-07-11 v1
- Checksum05F26F97F7F05DD4
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-23 | Basic and acidic residues | ||||
Sequence: MANPRVEELPDEEVPKTTVEDAG | ||||||
Compositional bias | 130-150 | Basic and acidic residues | ||||
Sequence: GEHAGHEHIDLGKGKAPETEK | ||||||
Compositional bias | 151-165 | Acidic residues | ||||
Sequence: KEEEEEEEGEVDETG |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
GG704915 EMBL· GenBank· DDBJ | EAS27545.3 EMBL· GenBank· DDBJ | Genomic DNA |