Q19202 · APY1_CAEEL
- ProteinApyrase apy-1
- Geneapy-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids355 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Hydrolyzes UDP and to a lesser extent GDP. By preventing the accumulation of NDP, may promote the reglucosylation of incompletely folded glycoproteins in the endoplasmic reticulum following the unfolded protein response.
Catalytic activity
- a ribonucleoside 5'-diphosphate + H2O = a ribonucleoside 5'-phosphate + H+ + phosphate
Cofactor
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endomembrane system | |
Cellular Component | membrane | |
Molecular Function | calcium ion binding | |
Molecular Function | GDP phosphatase activity | |
Molecular Function | UDP phosphatase activity | |
Biological Process | determination of adult lifespan | |
Biological Process | endoplasmic reticulum unfolded protein response | |
Biological Process | gastrulation | |
Biological Process | GDP catabolic process | |
Biological Process | pharynx development | |
Biological Process | proteoglycan biosynthetic process | |
Biological Process | regulation of growth rate | |
Biological Process | reproductive process | |
Biological Process | response to heat | |
Biological Process | UDP catabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameApyrase apy-1
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ19202
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endomembrane system ; Single-pass type II membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-6 | Cytoplasmic | ||||
Sequence: MTQESN | ||||||
Transmembrane | 7-29 | Helical; Signal-anchor for type II membrane protein | ||||
Sequence: SNFFNFLLFGFVTAIAFYSGTQF | ||||||
Topological domain | 30-355 | Lumenal | ||||
Sequence: NKSSEQEEHINHANLYSVKKFDDGAKEYSIMLITDLDHDSKDGKKWKSLVSRGFLKVSADHKHADIHFDKDSEYYVDTNIAAGGRAMELSDLAVFNGKLYSIDDRTGLIYQISDKKALPWVLLNDGPGNVVKGFKGEWITVKDTELIVGGLGKEWTTTDGVYVNDHPMWVKHVSAHGAVHHENWKDVYIRVRRAAGIEYPGYMIHEAVQWSAIHRKWFFLPRRMSNEKYSEAEDENRGTNVLVIGNEELTDFEVVRVGSENNKSRGFAAFQFVPNTHHQLIVAIKSEEKDGKPVASYASVFDIHGNVILDEYLLHGPYKYEGIAFA |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown causes a 50% reduction of progeny numbers and a slower growth. RNAi-mediated knockdown at the L4 larval stage results in a reduced lifespan and in the lysosomal accumulation of lipofuscin in the intestine with age. Motility is decreased and muscle sarcomeres are often patched or wrinkled. Moderate decrease in pharyngeal pumping associated with an abnormal pharynx morphology characterized by irregular and discontinued cell junction protein ajm-1 localization at the beginning and at the end of the procorpus and in the isthmus and a loss of one of the three loops forming the lumen. In addition, causes the up-regulation of ER stress marker hsp-4 which is prevented in an ire-1 mutant background. UDPase and to a lesser extent GDPase activities are reduced.
PTM/Processing
Features
Showing features for chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000437964 | 1-355 | Apyrase apy-1 | |||
Sequence: MTQESNSNFFNFLLFGFVTAIAFYSGTQFNKSSEQEEHINHANLYSVKKFDDGAKEYSIMLITDLDHDSKDGKKWKSLVSRGFLKVSADHKHADIHFDKDSEYYVDTNIAAGGRAMELSDLAVFNGKLYSIDDRTGLIYQISDKKALPWVLLNDGPGNVVKGFKGEWITVKDTELIVGGLGKEWTTTDGVYVNDHPMWVKHVSAHGAVHHENWKDVYIRVRRAAGIEYPGYMIHEAVQWSAIHRKWFFLPRRMSNEKYSEAEDENRGTNVLVIGNEELTDFEVVRVGSENNKSRGFAAFQFVPNTHHQLIVAIKSEEKDGKPVASYASVFDIHGNVILDEYLLHGPYKYEGIAFA | ||||||
Glycosylation | 30 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 291 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q19202 | sgt-1 Q21746 | 3 | EBI-319014, EBI-312019 |
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length355
- Mass (Da)40,310
- Last updated2001-10-01 v2
- Checksum4AD6F807FE9812AC
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX284606 EMBL· GenBank· DDBJ | CCD67349.1 EMBL· GenBank· DDBJ | Genomic DNA |