Q18779 · SQV7_CAEEL
- ProteinUDP-sugar transporter sqv-7
- Genesqv-7
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids329 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Acts as a transporter of UDP-glucuronic acid (UDP-GlcA), UDP-N-acetylgalactosamine (UDP-GalNAc) and UDP-galactose (UDP-Gal) from the cytoplasm into the Golgi lumen (PubMed:11259660, PubMed:17652078).
Involved in the biosynthesis of glycoconjugates that play a pivotal role in development (PubMed:11259660).
Involved in the synthesis of chondroitin sulfate and heparan sulfate proteoglycans (PubMed:11005858).
Required for embryonic development (PubMed:9927677).
Involved in vulva epithelium invagination and embryonic development (PubMed:11259660, PubMed:9927677).
Involved in the directed migration of hermaphrodite-specific neurons (PubMed:24052309).
Involved in the biosynthesis of glycoconjugates that play a pivotal role in development (PubMed:11259660).
Involved in the synthesis of chondroitin sulfate and heparan sulfate proteoglycans (PubMed:11005858).
Required for embryonic development (PubMed:9927677).
Involved in vulva epithelium invagination and embryonic development (PubMed:11259660, PubMed:9927677).
Involved in the directed migration of hermaphrodite-specific neurons (PubMed:24052309).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameUDP-sugar transporter sqv-7
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ18779
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Golgi apparatus membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 15-34 | Helical | ||||
Sequence: SAVFYGVISVLIVFVNKILL | ||||||
Transmembrane | 41-63 | Helical | ||||
Sequence: SFLFVGVGQMMATILILFFAKMF | ||||||
Transmembrane | 86-108 | Helical | ||||
Sequence: YFFNLISGLGGTQMINLPMFTVL | ||||||
Transmembrane | 129-151 | Helical | ||||
Sequence: SKAVKISVGLMIGGSFIAAIYDL | ||||||
Transmembrane | 155-174 | Helical | ||||
Sequence: ALGYTMIFINNICTAALGVY | ||||||
Transmembrane | 187-209 | Helical | ||||
Sequence: YGLMFYNCLFMLLPALCVVQYTG | ||||||
Transmembrane | 224-246 | Helical | ||||
Sequence: TSSVWTCFLLSCICGFVLNYSLV | ||||||
Transmembrane | 253-275 | Helical | ||||
Sequence: SALTTTCVGPIKNLFVTYVGMFS | ||||||
Transmembrane | 280-302 | Helical | ||||
Sequence: VFQWANFTGINVSVFGSILYTYV |
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 95 | In n2839; 50 percent reduction in brood size. Partial collapse of vulva invagination. Reduced levels of chondroitin and heparan sulfate proteoglycans associated with a reduction in the chondroitin chain length. | ||||
Sequence: G → D | ||||||
Mutagenesis | 151 | In n2844; F1 adults accumulate eggs in the uterus. Embryos are predominantly arrested at the bean/comma embryonic stage. | ||||
Sequence: L → P |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000213395 | 1-329 | UDP-sugar transporter sqv-7 | |||
Sequence: MTSTVQSPLYSRVFSAVFYGVISVLIVFVNKILLTNYKFPSFLFVGVGQMMATILILFFAKMFRIVQFPSLDSSIPRKIMPLPLLYFFNLISGLGGTQMINLPMFTVLRRFSILMTMILEFYILNVKASKAVKISVGLMIGGSFIAAIYDLSFDALGYTMIFINNICTAALGVYTKQKLDAKDLGKYGLMFYNCLFMLLPALCVVQYTGDLDRAYSFMLSDSMTSSVWTCFLLSCICGFVLNYSLVLCTHHNSALTTTCVGPIKNLFVTYVGMFSSGDYVFQWANFTGINVSVFGSILYTYVTFRSKSTTISYKPLPMTMPIDVHKPRN |
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Sequence similarities
Belongs to the TPT transporter family. SLC35D subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length329
- Mass (Da)36,893
- Last updated1996-11-01 v1
- Checksum152080BD2F80109B
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
FO080554 EMBL· GenBank· DDBJ | CCD64624.1 EMBL· GenBank· DDBJ | Genomic DNA |