Q18434 · GPA17_CAEEL
- ProteinGuanine nucleotide-binding protein alpha-17 subunit
- Geneodr-3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids356 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems (PubMed:10192394).
This specific G-alpha subunit plays an important role in olfaction and in cilia morphogenesis (PubMed:15342507, PubMed:9459442).
Involved in chemotactic responses to attractants diacetyl, pyrazine, 2,4,5-trimethylthiazole, benzaldehyde, isoamyl alcohol, butanone and 2,3-pentanedione (PubMed:12694294).
Displays a redundant function with gpa-3 in chemotactic responses (PubMed:12694294).
Plays a role in the avoidance response to the noxious chemical quinine in ASH sensory neurons (PubMed:14988722).
Involved in avoidance responses to copper, sodium dodecyl sulfate and linoleic acid (PubMed:12694294).
Involved in osmotic avoidance and mechanosensory responses (PubMed:12694294).
Involved in specifying fan-like morphology of cilia of head sensory neurons AWC (PubMed:9459442).
Plays a role in the detection of preferred food sources by mediating the recognition of food odors in olfactory sensory neurons (PubMed:25009271).
This specific G-alpha subunit plays an important role in olfaction and in cilia morphogenesis (PubMed:15342507, PubMed:9459442).
Involved in chemotactic responses to attractants diacetyl, pyrazine, 2,4,5-trimethylthiazole, benzaldehyde, isoamyl alcohol, butanone and 2,3-pentanedione (PubMed:12694294).
Displays a redundant function with gpa-3 in chemotactic responses (PubMed:12694294).
Plays a role in the avoidance response to the noxious chemical quinine in ASH sensory neurons (PubMed:14988722).
Involved in avoidance responses to copper, sodium dodecyl sulfate and linoleic acid (PubMed:12694294).
Involved in osmotic avoidance and mechanosensory responses (PubMed:12694294).
Involved in specifying fan-like morphology of cilia of head sensory neurons AWC (PubMed:9459442).
Plays a role in the detection of preferred food sources by mediating the recognition of food odors in olfactory sensory neurons (PubMed:25009271).
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 40-47 | GTP (UniProtKB | ChEBI) | ||||
Sequence: GAGECGKS | ||||||
Binding site | 47 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 177-183 | GTP (UniProtKB | ChEBI) | ||||
Sequence: LYSRVAT | ||||||
Binding site | 183 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 202-206 | GTP (UniProtKB | ChEBI) | ||||
Sequence: DVGGQ | ||||||
Binding site | 271-274 | GTP (UniProtKB | ChEBI) | ||||
Sequence: NKKD | ||||||
Binding site | 328 | GTP (UniProtKB | ChEBI) | ||||
Sequence: A |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | dendrite | |
Cellular Component | heterotrimeric G-protein complex | |
Cellular Component | neuronal cell body | |
Cellular Component | non-motile cilium | |
Molecular Function | G protein-coupled receptor binding | |
Molecular Function | G-protein beta/gamma-subunit complex binding | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Molecular Function | metal ion binding | |
Molecular Function | olfactory receptor binding | |
Biological Process | adenylate cyclase-modulating G protein-coupled receptor signaling pathway | |
Biological Process | chemotaxis | |
Biological Process | cilium assembly | |
Biological Process | hyperosmotic response | |
Biological Process | olfactory behavior | |
Biological Process | response to odorant | |
Biological Process | sensory perception of smell |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameGuanine nucleotide-binding protein alpha-17 subunit
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ18434
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: In amphid neurons also weakly expressed in cell body. In phasmid neurons found only in cilia.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Defective in chemotactic responses to attractants and repellents and in osmotic and mechanosensory avoidance.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 47 | Loss of chemotactic responses. | ||||
Sequence: S → C | ||||||
Mutagenesis | 185 | In ky879; defects in GPCR expression in the AWC neurons. | ||||
Sequence: G → S | ||||||
Mutagenesis | 206 | Loss of chemotactic and osmotic avoidance responses. | ||||
Sequence: Q → L |
PTM/Processing
Features
Showing features for initiator methionine, lipidation, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Lipidation | 2 | N-myristoyl glycine | ||||
Sequence: G | ||||||
Chain | PRO_0000203659 | 2-356 | Guanine nucleotide-binding protein alpha-17 subunit | |||
Sequence: GSCQSNENSEGNARNKEIEKQLNADKRAGSSIVKLLLLGAGECGKSTVLKQMQILHSNGFTEEEVNEKRAIVYNNTVSAMCTILRAMDGVLHLPLENGQKEAEKAIVMKVQENGEEGEALTEEVSKAIQSLWADPGVKKAFEMRSEYQLPDSAKYFLDNCQRISEPGYRPNDQDILYSRVATTGVVEVKFKIKELDFRVFDVGGQRSERRKWIHCFDNVESIIFITAISEYDQVLFEDETTNRMIESMQLFNSICNSTWFLSTAMILFMNKKDLFMEKIQRVNITTAFPDYEGGQNYEEAVSFIKQKFAELNLNPDKKTIYMHETCATDTNQVQLVISSVIDTIIQKNLQKAGMM | ||||||
Lipidation | 4 | S-palmitoyl cysteine | ||||
Sequence: C |
Keywords
- PTM
Proteomic databases
Expression
Tissue specificity
Expressed in sensory neurons in the head and tail. Expressed in amphid AWC neurons, to a lesser extent in AWB and weakly in AWA, ASH and ADF neurons (head sensory neurons). Expressed in phasmid PHA and PHB neurons (tail sensory neurons).
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 32-356 | G-alpha | ||||
Sequence: SIVKLLLLGAGECGKSTVLKQMQILHSNGFTEEEVNEKRAIVYNNTVSAMCTILRAMDGVLHLPLENGQKEAEKAIVMKVQENGEEGEALTEEVSKAIQSLWADPGVKKAFEMRSEYQLPDSAKYFLDNCQRISEPGYRPNDQDILYSRVATTGVVEVKFKIKELDFRVFDVGGQRSERRKWIHCFDNVESIIFITAISEYDQVLFEDETTNRMIESMQLFNSICNSTWFLSTAMILFMNKKDLFMEKIQRVNITTAFPDYEGGQNYEEAVSFIKQKFAELNLNPDKKTIYMHETCATDTNQVQLVISSVIDTIIQKNLQKAGMM | ||||||
Region | 35-48 | G1 motif | ||||
Sequence: KLLLLGAGECGKST | ||||||
Region | 175-183 | G2 motif | ||||
Sequence: DILYSRVAT | ||||||
Region | 198-207 | G3 motif | ||||
Sequence: FRVFDVGGQR | ||||||
Region | 267-274 | G4 motif | ||||
Sequence: ILFMNKKD | ||||||
Region | 326-331 | G5 motif | ||||
Sequence: TCATDT |
Sequence similarities
Belongs to the G-alpha family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length356
- Mass (Da)40,434
- Last updated1996-11-01 v1
- ChecksumCB9F36F5F4FB95D9
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY008142 EMBL· GenBank· DDBJ | AAG32095.1 EMBL· GenBank· DDBJ | mRNA | ||
FJ455729 EMBL· GenBank· DDBJ | ACQ43989.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FJ455730 EMBL· GenBank· DDBJ | ACQ43990.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FJ455731 EMBL· GenBank· DDBJ | ACQ43991.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX284605 EMBL· GenBank· DDBJ | CAB01489.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY146558 EMBL· GenBank· DDBJ | AAN78230.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY146559 EMBL· GenBank· DDBJ | AAN78231.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY146560 EMBL· GenBank· DDBJ | AAN78232.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY146561 EMBL· GenBank· DDBJ | AAN78233.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY146562 EMBL· GenBank· DDBJ | AAN78234.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY146563 EMBL· GenBank· DDBJ | AAN78235.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY146564 EMBL· GenBank· DDBJ | AAN78236.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY146565 EMBL· GenBank· DDBJ | AAN78237.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY146566 EMBL· GenBank· DDBJ | AAN78238.1 EMBL· GenBank· DDBJ | Genomic DNA |