Q18158 · SWM1_CAEEL
- ProteinSerine protease inhibitor swm-1
- Geneswm-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids135 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Serine protease inhibitor (Probable) (PubMed:22125495).
Probably by inhibiting serine protease tyr-5 in males, prevents the maturation of spermatids into mature motile spermatozoa until their transfer into a hermaphrodite (PubMed:16461278, PubMed:22125495, PubMed:30470702).
Also required for efficient sperm transfer and thus for male fertility (PubMed:16461278).
Probably by inhibiting serine protease tyr-5 in males, prevents the maturation of spermatids into mature motile spermatozoa until their transfer into a hermaphrodite (PubMed:16461278, PubMed:22125495, PubMed:30470702).
Also required for efficient sperm transfer and thus for male fertility (PubMed:16461278).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Cellular Component | secretory vesicle | |
Molecular Function | serine-type endopeptidase inhibitor activity | |
Biological Process | spermatid development |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameSerine protease inhibitor swm-1
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ18158
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: In males, partially colocalizes with tyr-5 in vesicles near the apical membrane of cuboidal cells. Secreted predominantly by muscles into the pseudocoelom where it enters the seminal vesicle in males and the spermatheca in hermaphrodites. Localizes around the spermatocytes at the late stages of meiosis. During mating, transferred together with sperm into hermaphrodites where it spreads into the uterus. Also, is uptaken by coelomocytes.
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 38 | In me86; severe reduction in male fertility caused by a premature activation of spermatids and impaired sperm transfer into the hermaphrodite. Seminal fluid transfer and trans-activation of hermaphrodite sperm are normal. Does not affect hermaphrodite self-fertility. In a tyr-5(jn21) mutant background, suppresses premature sperm activation in males. | ||||
Sequence: G → E | ||||||
Mutagenesis | 80 | In me66; severe reduction in male fertility caused by a premature activation of spermatids and impaired sperm transfer into the hermaphrodite. Seminal fluid transfer and trans-activation of hermaphrodite sperm are normal. In a tyr-5(jn21) mutant background, suppresses premature sperm activation in males. | ||||
Sequence: C → Y |
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-16 | |||||
Sequence: MRILVIITCIVAVATA | ||||||
Chain | PRO_5004186764 | 17-135 | Serine protease inhibitor swm-1 | |||
Sequence: TKTCEANEELVSCHNTCEPQCGYTPKACTEQCIMNTCDCKDGFVRNSLGKCVEVSECTKETTKCPENETFFGCGTACEATCEKPNPTVCTKQCIVNVCQCSKGFVRHGLRCIDKKDCPK | ||||||
Disulfide bond | 20↔53 | |||||
Sequence: CEANEELVSCHNTCEPQCGYTPKACTEQCIMNTC | ||||||
Disulfide bond | 29↔48 | |||||
Sequence: CHNTCEPQCGYTPKACTEQC | ||||||
Disulfide bond | 33↔44 | |||||
Sequence: CEPQCGYTPKAC | ||||||
Disulfide bond | 37↔73 | |||||
Sequence: CGYTPKACTEQCIMNTCDCKDGFVRNSLGKCVEVSEC | ||||||
Disulfide bond | 55↔67 | |||||
Sequence: CKDGFVRNSLGKC | ||||||
Disulfide bond | 80↔114 | |||||
Sequence: CPENETFFGCGTACEATCEKPNPTVCTKQCIVNVC | ||||||
Glycosylation | 83 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 89↔109 | |||||
Sequence: CGTACEATCEKPNPTVCTKQC | ||||||
Disulfide bond | 93↔105 | |||||
Sequence: CEATCEKPNPTVC | ||||||
Disulfide bond | 97↔133 | |||||
Sequence: CEKPNPTVCTKQCIVNVCQCSKGFVRHGLRCIDKKDC | ||||||
Disulfide bond | 116↔127 | |||||
Sequence: CSKGFVRHGLRC |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
In male, expressed in the vas deferens cuboidal cells and, in posterior body wall and male-specific diagonal muscles (PubMed:30470702).
In hermaphrodites, expressed in posterior body wall muscles and spermatheca (PubMed:30470702).
In hermaphrodites, expressed in posterior body wall muscles and spermatheca (PubMed:30470702).
Developmental stage
In males, expression begins at late larval stage and continues in adults.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 20-73 | TIL 1 | ||||
Sequence: CEANEELVSCHNTCEPQCGYTPKACTEQCIMNTCDCKDGFVRNSLGKCVEVSEC | ||||||
Domain | 80-133 | TIL 2 | ||||
Sequence: CPENETFFGCGTACEATCEKPNPTVCTKQCIVNVCQCSKGFVRHGLRCIDKKDC |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length135
- Mass (Da)14,737
- Last updated1996-11-01 v1
- ChecksumC8FCFC7464903255
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX284605 EMBL· GenBank· DDBJ | CCD65654.1 EMBL· GenBank· DDBJ | Genomic DNA |