Q18053 · HLH26_CAEEL
- ProteinHelix-loop-helix protein 26
- Genehlh-26
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids210 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
As a homodimer binds DNA via the E-box sequence 5'-CACGTG-3' (PubMed:19632181).
Represses lag-2 transcription during embryogenesis via Notch signaling, in an unc-37-dependent manner (PubMed:15935776).
Also represses tbx-37 independent of Notch signaling (PubMed:15935776).
In the intestine, plays a role in probiotic-mediated protection against infections by pathogens such as S.enterica (PubMed:35263319).
This is most likely by positively regulating the expression of genes such as bar-1 upon exposure to probiotic bacteria such as the E.faecium (PubMed:35263319).
Represses lag-2 transcription during embryogenesis via Notch signaling, in an unc-37-dependent manner (PubMed:15935776).
Also represses tbx-37 independent of Notch signaling (PubMed:15935776).
In the intestine, plays a role in probiotic-mediated protection against infections by pathogens such as S.enterica (PubMed:35263319).
This is most likely by positively regulating the expression of genes such as bar-1 upon exposure to probiotic bacteria such as the E.faecium (PubMed:35263319).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | protein dimerization activity | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Biological Process | anterior/posterior pattern specification | |
Biological Process | Notch signaling pathway | |
Biological Process | regulation of neurogenesis | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameHelix-loop-helix protein 26
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ18053
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown in the intestine decreases the E.faecium-mediated protection against S. enterica infection (PubMed:35263319).
RNAi-mediated knockdown reduces the expression of genes including bar-1 following E.faecium infection (PubMed:35263319).
RNAi-mediated knockdown in the germline or the nervous system does not affect E.faecium-mediated protection against S.enterica infection (PubMed:35263319).
RNAi-mediated knockdown reduces the expression of genes including bar-1 following E.faecium infection (PubMed:35263319).
RNAi-mediated knockdown in the germline or the nervous system does not affect E.faecium-mediated protection against S.enterica infection (PubMed:35263319).
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000388708 | 1-210 | Helix-loop-helix protein 26 | |||
Sequence: MSSSPTSSSSGSPSSHGHRSETEKQRRDDTNDLLNEFKKIVQKSESEKLSKEEVLFRIVKLLSGIQLHHESFSTSPGPIRSIKKIKSDREQVRRNKRVAAYRELRKFIALNNLSSSEEIDKMENLKVLEIIFEVIRGKSITCTVPCLPFPILPFLPVFPVYSPLVFNSYNQFSLYPPHMPTVQIPIVPSSSFEIDALEIEENEKDIDIVG |
Proteomic databases
Expression
Tissue specificity
Expressed in intestinal cells (at protein level).
Developmental stage
Expressed in AB cell descendants in embryos.
Gene expression databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-16 | Polar residues | ||||
Sequence: MSSSPTSSSSGSPSSH | ||||||
Region | 1-33 | Disordered | ||||
Sequence: MSSSPTSSSSGSPSSHGHRSETEKQRRDDTNDL | ||||||
Domain | 14-65 | bHLH | ||||
Sequence: SSHGHRSETEKQRRDDTNDLLNEFKKIVQKSESEKLSKEEVLFRIVKLLSGI | ||||||
Compositional bias | 17-33 | Basic and acidic residues | ||||
Sequence: GHRSETEKQRRDDTNDL |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length210
- Mass (Da)23,874
- Last updated1996-11-01 v1
- Checksum539C6E789C7350A6
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-16 | Polar residues | ||||
Sequence: MSSSPTSSSSGSPSSH | ||||||
Compositional bias | 17-33 | Basic and acidic residues | ||||
Sequence: GHRSETEKQRRDDTNDL |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX284602 EMBL· GenBank· DDBJ | CCD64839.1 EMBL· GenBank· DDBJ | Genomic DNA |