Q17334 · ADH1_CAEEL
- ProteinAlcohol dehydrogenase 1
- Genesodh-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids349 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
Catalytic activity
- a primary alcohol + NAD+ = an aldehyde + H+ + NADH
Cofactor
Note: Binds 2 Zn2+ ions per subunit.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 46 | Zn2+ 1 (UniProtKB | ChEBI); catalytic | ||||
Sequence: C | ||||||
Binding site | 69 | Zn2+ 1 (UniProtKB | ChEBI); catalytic | ||||
Sequence: H | ||||||
Binding site | 100 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 103 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 106 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 114 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 156 | Zn2+ 1 (UniProtKB | ChEBI); catalytic | ||||
Sequence: C | ||||||
Binding site | 180-186 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: GAGGGLG | ||||||
Binding site | 204 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 208 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 270-272 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: VGL | ||||||
Binding site | 342 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: R |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | alcohol dehydrogenase (NAD+) activity | |
Molecular Function | zinc ion binding | |
Biological Process | defense response to Gram-positive bacterium |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAlcohol dehydrogenase 1
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ17334
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000160693 | 1-349 | Alcohol dehydrogenase 1 | |||
Sequence: MTVELPSTQRALVFDTWNGPLEVRQVPVPSPADDEILVKIEYSGICHSDLHVWLGDLKDMSVCPLVGGHEGAGSVVQIGKNVTGWQLGDKAGVKLMNFNCLNCEFCKKGHEPLCHHIQNYGFDRSGTFQEYLTIRGVDAAKINKDTNLAAAAPILCAGVTVYKALKESNVAPGQIIVLTGAGGGLGSLAIQYACAMGMRVVAMDHGSKEAHCKGLGAEWFVDAFETPDIVSHITKLTEGGPHGVINFAVARKPMEQAVEYVRKRGTVVFVGLPKDSKVTFDTTPFIFNAITIKGSIVGSRLDVDEAMEFVTRGIVKVPLELVKLEDVPAVYQRMLDGKINSRAVVDFSL |
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Length349
- Mass (Da)37,697
- Last updated2000-05-30 v2
- Checksum94B2752CFCAC977E
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 111-112 | in Ref. 2; AAB03373 | ||||
Sequence: EP → DA | ||||||
Sequence conflict | 207 | in Ref. 2; AAB03373 | ||||
Sequence: S → R | ||||||
Sequence conflict | 248 | in Ref. 2; AAB03373 | ||||
Sequence: A → G | ||||||
Sequence conflict | 307 | in Ref. 2; AAB03373 | ||||
Sequence: M → I | ||||||
Sequence conflict | 344 | in Ref. 2; AAB03373 | ||||
Sequence: V → G |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Z81570 EMBL· GenBank· DDBJ | CAB04604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U18780 EMBL· GenBank· DDBJ | AAB03373.1 EMBL· GenBank· DDBJ | mRNA |