Q16663 · CCL15_HUMAN
- ProteinC-C motif chemokine 15
- GeneCCL15
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids113 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Chemotactic factor that attracts T-cells and monocytes, but not neutrophils, eosinophils, or B-cells. Acts mainly via CC chemokine receptor CCR1. Also binds to CCR3. CCL15(22-92), CCL15(25-92) and CCL15(29-92) are more potent chemoattractants than the CCL15.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Molecular Function | CCR chemokine receptor binding | |
Molecular Function | chemoattractant activity | |
Molecular Function | chemokine activity | |
Molecular Function | heparin binding | |
Molecular Function | signaling receptor binding | |
Biological Process | antimicrobial humoral immune response mediated by antimicrobial peptide | |
Biological Process | cell-cell signaling | |
Biological Process | chemokine-mediated signaling pathway | |
Biological Process | chemotaxis | |
Biological Process | eosinophil chemotaxis | |
Biological Process | inflammatory response | |
Biological Process | intracellular calcium ion homeostasis | |
Biological Process | positive regulation of cell migration | |
Biological Process | signal transduction |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameC-C motif chemokine 15
- Alternative names
- Cleaved into 3 chains
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ16663
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_011640 | 24 | in dbSNP:rs854625 | |||
Sequence: T → I |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 131 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-21 | |||||
Sequence: MKVSVAALSCLMLVAVLGSQA | ||||||
Chain | PRO_0000005208 | 22-113 | C-C motif chemokine 15 | |||
Sequence: QFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI | ||||||
Chain | PRO_0000041868 | 43-113 | CCL15(22-92) | |||
Sequence: VLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI | ||||||
Chain | PRO_0000041869 | 46-113 | CCL15(25-92) | |||
Sequence: SFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI | ||||||
Chain | PRO_0000041870 | 50-113 | CCL15(29-92) | |||
Sequence: AADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI | ||||||
Disulfide bond | 53↔77 | |||||
Sequence: CCTSYISQSIPCSLMKSYFETSSEC | ||||||
Disulfide bond | 54↔93 | |||||
Sequence: CTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVC | ||||||
Disulfide bond | 64↔104 | |||||
Sequence: CSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDC |
Post-translational modification
The N-terminal is proteolytically cleaved by proteases associated with inflammatory responses. The processed forms CCL15(22-92), CCL15(25-92) and CCL15(29-92) exhibit increase in CCR1-mediated signaling and chemotaxis assays in vitro.
Keywords
- PTM
Proteomic databases
Expression
Tissue specificity
Most abundant in heart, skeletal muscle and adrenal gland. Lower levels in placenta, liver, pancreas and bone marrow. CCL15(22-92), CCL15(25-92) and CCL15(29-92) are found in high levels in synovial fluids from rheumatoid patients.
Gene expression databases
Organism-specific databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length113
- Mass (Da)12,236
- Last updated2022-02-23 v3
- Checksum0BBC31FB696E16C9
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A087X1J9 | A0A087X1J9_HUMAN | CCL15 | 61 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 14 | in Ref. 1; AAD10847 | ||||
Sequence: V → I |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U58914 EMBL· GenBank· DDBJ | AAD10847.1 EMBL· GenBank· DDBJ | mRNA | ||
AF031587 EMBL· GenBank· DDBJ | AAB94617.1 EMBL· GenBank· DDBJ | mRNA | ||
Z70293 EMBL· GenBank· DDBJ | CAA94308.1 EMBL· GenBank· DDBJ | mRNA | ||
Z70292 EMBL· GenBank· DDBJ | CAA94306.1 EMBL· GenBank· DDBJ | mRNA | ||
AF088219 EMBL· GenBank· DDBJ | AAC63328.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471147 EMBL· GenBank· DDBJ | EAW80110.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471147 EMBL· GenBank· DDBJ | EAW80111.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471147 EMBL· GenBank· DDBJ | EAW80112.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471147 EMBL· GenBank· DDBJ | EAW80113.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC140941 EMBL· GenBank· DDBJ | AAI40942.1 EMBL· GenBank· DDBJ | mRNA |