Q15546 · PAQRB_HUMAN
- ProteinMonocyte to macrophage differentiation factor
- GeneMMD
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids238 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in the dynamics of lysosomal membranes associated with microglial activation following brain lesion.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | Golgi apparatus | |
Cellular Component | late endosome membrane | |
Cellular Component | lysosomal membrane | |
Cellular Component | membrane | |
Cellular Component | plasma membrane | |
Molecular Function | pore-forming activity | |
Molecular Function | protein kinase activity | |
Molecular Function | signaling receptor activity | |
Biological Process | positive regulation of neuron differentiation | |
Biological Process | positive regulation of protein kinase activity | |
Biological Process | regulation of protein localization |
Keywords
- Molecular function
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameMonocyte to macrophage differentiation factor
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ15546
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Late endosome membrane ; Multi-pass membrane protein
Lysosome membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-28 | Cytoplasmic | ||||
Sequence: MRFKNRFQRFMNHRAPANGRYKPTCYEH | ||||||
Transmembrane | 29-49 | Helical | ||||
Sequence: AANCYTHAFLIVPAIVGSALL | ||||||
Topological domain | 50-61 | Lumenal | ||||
Sequence: HRLSDDCWEKIT | ||||||
Transmembrane | 62-82 | Helical | ||||
Sequence: AWIYGMGLCALFIVSTVFHIV | ||||||
Topological domain | 83-101 | Cytoplasmic | ||||
Sequence: SWKKSHLRTVEHCFHMCDR | ||||||
Transmembrane | 102-122 | Helical | ||||
Sequence: MVIYFFIAASYAPWLNLRELG | ||||||
Topological domain | 123-124 | Lumenal | ||||
Sequence: PL | ||||||
Transmembrane | 125-145 | Helical | ||||
Sequence: ASHMRWFIWLMAAGGTIYVFL | ||||||
Topological domain | 146-151 | Cytoplasmic | ||||
Sequence: YHEKYK | ||||||
Transmembrane | 152-172 | Helical | ||||
Sequence: VVELFFYLTMGFSPALVVTSM | ||||||
Topological domain | 173-174 | Lumenal | ||||
Sequence: NN | ||||||
Transmembrane | 175-195 | Helical | ||||
Sequence: TDGLQELACGGLIYCLGVVFF | ||||||
Topological domain | 196-198 | Cytoplasmic | ||||
Sequence: KSD | ||||||
Transmembrane | 199-219 | Helical | ||||
Sequence: GIIPFAHAIWHLFVATAAAVH | ||||||
Topological domain | 220-238 | Lumenal | ||||
Sequence: YYAIWKYLYRSPTDFMRHL |
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 219 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000218854 | 1-238 | Monocyte to macrophage differentiation factor | |||
Sequence: MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKITAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRELGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQELACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFMRHL |
Proteomic databases
PTM databases
Expression
Tissue specificity
Exhibits relatively ubiquitous expression with preferential expression in mature (in vitro differentiated) macrophages.
Gene expression databases
Organism-specific databases
Interaction
Binary interactions
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length238
- Mass (Da)27,667
- Last updated2005-04-12 v2
- Checksum0B7328C85911F184
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A3B3ITQ3 | A0A3B3ITQ3_HUMAN | MMD | 269 | ||
I3L1Y1 | I3L1Y1_HUMAN | MMD | 147 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 75 | in Ref. 1; CAA59752 | ||||
Sequence: V → A | ||||||
Sequence conflict | 92 | in Ref. 1; CAA59752 | ||||
Sequence: V → A |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X85750 EMBL· GenBank· DDBJ | CAA59752.1 EMBL· GenBank· DDBJ | mRNA | ||
AY424289 EMBL· GenBank· DDBJ | AAR08377.1 EMBL· GenBank· DDBJ | mRNA | ||
CR541893 EMBL· GenBank· DDBJ | CAG46691.1 EMBL· GenBank· DDBJ | mRNA | ||
AK312760 EMBL· GenBank· DDBJ | BAG35626.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471109 EMBL· GenBank· DDBJ | EAW94541.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471109 EMBL· GenBank· DDBJ | EAW94542.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC026324 EMBL· GenBank· DDBJ | AAH26324.1 EMBL· GenBank· DDBJ | mRNA |