Q15528 · MED22_HUMAN
- ProteinMediator of RNA polymerase II transcription subunit 22
- GeneMED22
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids200 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | core mediator complex | |
Cellular Component | cytoplasm | |
Cellular Component | mediator complex | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Molecular Function | transcription coregulator activity | |
Biological Process | positive regulation of transcription elongation by RNA polymerase II | |
Biological Process | positive regulation of transcription initiation by RNA polymerase II | |
Biological Process | RNA polymerase II preinitiation complex assembly |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameMediator of RNA polymerase II transcription subunit 22
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ15528
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 588 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000178838 | 1-200 | UniProt | Mediator of RNA polymerase II transcription subunit 22 | |||
Sequence: MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSSSSLCEANDLPLCEAYGRLDLDTDSADGLSAPLLASPEPSAGPLQVAAPAHSHAGGPGPTEHA | |||||||
Modified residue (large scale data) | 173 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Component of the Mediator complex, which is composed of MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11. The MED12, MED13, CCNC and CDK8 subunits form a distinct module termed the CDK8 module. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation. Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q15528 | MED11 Q9P086 | 6 | EBI-394687, EBI-394704 | |
XENO | Q15528 | Med11 Q9D8C6 | 2 | EBI-394687, EBI-6260909 | |
BINARY | Q15528 | MED17 Q9NVC6 | 7 | EBI-394687, EBI-394562 | |
BINARY | Q15528 | MED18 Q9BUE0 | 7 | EBI-394687, EBI-394640 | |
BINARY | Q15528 | MED27 Q6P2C8 | 7 | EBI-394687, EBI-394603 | |
BINARY | Q15528 | MED28 Q9H204 | 6 | EBI-394687, EBI-514199 | |
BINARY | Q15528 | MED29 Q9NX70 | 9 | EBI-394687, EBI-394656 | |
XENO | Q15528 | Med30 Q9CQI9 | 6 | EBI-394687, EBI-309220 | |
XENO | Q15528 | Med8 Q9D7W5 | 2 | EBI-394687, EBI-7990252 | |
BINARY | Q15528-2 | HGS O14964 | 3 | EBI-12954271, EBI-740220 | |
BINARY | Q15528-2 | HTT P42858 | 12 | EBI-12954271, EBI-466029 | |
BINARY | Q15528-2 | NTAQ1 Q96HA8 | 3 | EBI-12954271, EBI-741158 | |
BINARY | Q15528-2 | PRPS1 P60891 | 3 | EBI-12954271, EBI-749195 | |
BINARY | Q15528-2 | TXNDC9 O14530 | 3 | EBI-12954271, EBI-707554 | |
BINARY | Q15528-2 | WFS1 O76024 | 3 | EBI-12954271, EBI-720609 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for coiled coil, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 93-122 | |||||
Sequence: SVNEAIDQRNQQLRTLQEECDRKLITLRDE | ||||||
Region | 166-200 | Disordered | ||||
Sequence: LSAPLLASPEPSAGPLQVAAPAHSHAGGPGPTEHA |
Sequence similarities
Belongs to the Mediator complex subunit 22 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q15528-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameSurf5B
- Length200
- Mass (Da)22,221
- Last updated1999-07-15 v2
- Checksum113BBF7C35B03F7B
Q15528-2
- NameSurf5A
- Differences from canonical
- 138-200: SSSLCEANDLPLCEAYGRLDLDTDSADGLSAPLLASPEPSAGPLQVAAPAHSHAGGPGPTEHA → RYK
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_006309 | 138-200 | in isoform Surf5A | |||
Sequence: SSSLCEANDLPLCEAYGRLDLDTDSADGLSAPLLASPEPSAGPLQVAAPAHSHAGGPGPTEHA → RYK |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X85178 EMBL· GenBank· DDBJ | CAA59462.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ224639 EMBL· GenBank· DDBJ | CAA12052.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ224639 EMBL· GenBank· DDBJ | CAA12053.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ224358 EMBL· GenBank· DDBJ | CAA11915.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ224359 EMBL· GenBank· DDBJ | CAA11916.1 EMBL· GenBank· DDBJ | mRNA | ||
AK124518 EMBL· GenBank· DDBJ | BAG54045.1 EMBL· GenBank· DDBJ | mRNA | ||
AK126069 EMBL· GenBank· DDBJ | BAG54286.1 EMBL· GenBank· DDBJ | mRNA | ||
AL158826 EMBL· GenBank· DDBJ | CAI12827.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471090 EMBL· GenBank· DDBJ | EAW88056.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471090 EMBL· GenBank· DDBJ | EAW88060.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC024225 EMBL· GenBank· DDBJ | AAH24225.1 EMBL· GenBank· DDBJ | mRNA | ||
BC040111 EMBL· GenBank· DDBJ | AAH40111.1 EMBL· GenBank· DDBJ | mRNA |