Q14TB1 · Q14TB1_TOBAC
- ProteinHeat shock cognate protein 80-like
- Genehsp90
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids699 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 34 | ATP (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 38 | ATP (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 80 | ATP (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 85 | ATP (UniProtKB | ChEBI) | ||||
Sequence: M | ||||||
Binding site | 93 | ATP (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 100-101 | ATP (UniProtKB | ChEBI) | ||||
Sequence: SG | ||||||
Binding site | 120-125 | ATP (UniProtKB | ChEBI) | ||||
Sequence: QFGVGF | ||||||
Binding site | 172 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 371 | ATP (UniProtKB | ChEBI) | ||||
Sequence: R |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | perinuclear region of cytoplasm | |
Cellular Component | plasma membrane | |
Cellular Component | protein-containing complex | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | ATP-dependent protein folding chaperone | |
Molecular Function | unfolded protein binding | |
Biological Process | cellular response to heat | |
Biological Process | protein folding | |
Biological Process | protein stabilization |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > asterids > lamiids > Solanales > Solanaceae > Nicotianoideae > Nicotianeae > Nicotiana
Accessions
- Primary accessionQ14TB1
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 27-182 | Histidine kinase/HSP90-like ATPase | ||||
Sequence: NKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKEDQ | ||||||
Compositional bias | 219-238 | Acidic residues | ||||
Sequence: SDDEEEEEKKDEEGKVEEVD | ||||||
Region | 219-248 | Disordered | ||||
Sequence: SDDEEEEEKKDEEGKVEEVDEEKEMEEKKK | ||||||
Region | 674-699 | Disordered | ||||
Sequence: GDADVDMPALEDPEADAEGSKMEEVD |
Sequence similarities
Belongs to the heat shock protein 90 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length699
- Mass (Da)80,209
- Last updated2006-08-22 v1
- Checksum7A3DA638F534427C
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 219-238 | Acidic residues | ||||
Sequence: SDDEEEEEKKDEEGKVEEVD |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB264546 EMBL· GenBank· DDBJ | BAE97400.1 EMBL· GenBank· DDBJ | mRNA | ||
AB689674 EMBL· GenBank· DDBJ | BAM24708.1 EMBL· GenBank· DDBJ | mRNA |