Q14CN4 · K2C72_HUMAN
- ProteinKeratin, type II cytoskeletal 72
- GeneKRT72
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids511 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Has a role in hair formation. Specific component of keratin intermediate filaments in the inner root sheath (IRS) of the hair follicle (Probable).
Miscellaneous
There are two types of cytoskeletal and microfibrillar keratin, I (acidic) and II (neutral to basic) (40-55 and 56-70 kDa, respectively).
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 376 | Stutter | ||||
Sequence: Q |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | extracellular exosome | |
Cellular Component | keratin filament | |
Molecular Function | structural constituent of skin epidermis | |
Biological Process | intermediate filament organization | |
Biological Process | keratinization |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameKeratin, type II cytoskeletal 72
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ14CN4
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_038087 | 171 | in dbSNP:rs11170187 | |||
Sequence: N → D | ||||||
Natural variant | VAR_038088 | 264 | in dbSNP:rs12833456 | |||
Sequence: Y → C | ||||||
Natural variant | VAR_061298 | 326 | in dbSNP:rs34769047 | |||
Sequence: Q → E | ||||||
Natural variant | VAR_038089 | 366 | in dbSNP:rs7310138 | |||
Sequence: D → E | ||||||
Natural variant | VAR_038090 | 428 | in dbSNP:rs11170183 | |||
Sequence: R → L |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 797 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000314877 | 1-511 | Keratin, type II cytoskeletal 72 | |||
Sequence: MSRQLTHFPRGERLGFSGCSAVLSGGIGSSSASFRARVKGSASFGSKSLSCLGGSRSLALSAAARRGGGRLGGFVGTAFGSAGLGPKCPSVCPPGGIPQVTVNKSLLAPLNVEMDPEIQRVRAQEREQIKALNNKFASFIDKVRFLEQQNQVLETKWNLLQQLDLNNCRKNLEPIYEGYISNLQKQLEMLSGDGVRLDSELRNMQDLVEDYKKRYEVEINRRTAAENEFVVLKKDVDAAYMNKVELQAKVDSLTDEIKFFKCLYEGEITQIQSHISDTSIVLSMDNNRDLDLDSIIAEVRAQYEEIALKSKAEAETLYQTKIQELQVTAGQHGDDLKLTKAEISELNRLIQRIRSEIGNVKKQCADLETAIADAEQRGDCALKDARAKLDELEGALHQAKEELARMLREYQELVSLKLALDMEIATYRKLLESEECRMSGEYPNSVSISVISSTNAGAGGAGFSMGFGASSSYSYKTAAADVKTKGSCGSELKDPLAKTSGSSCATKKASR |
Proteomic databases
PTM databases
Expression
Tissue specificity
Highly expressed in hair follicles from scalp and eyebrow. Also expressed in palmoplantar epidermis. Not expressed in face skin despite the presence of fine hairs histologically. In hair, it is specifically present in the inner root sheath (IRS) of the hair follicle. Present in the IRS cuticle, but not in Henle or Huxley layers of the IRS. In the IRS cuticle, its presence is delayed up to the height of the apex of the dermal papilla (at protein level).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Heterotetramer of two type I and two type II keratins.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q14CN4 | BLOC1S6 Q9UL45 | 3 | EBI-1221280, EBI-465781 | |
BINARY | Q14CN4 | KRT13 P13646 | 3 | EBI-1221280, EBI-1223876 | |
BINARY | Q14CN4 | KRT14 P02533 | 3 | EBI-1221280, EBI-702178 | |
BINARY | Q14CN4 | KRT15 P19012 | 3 | EBI-1221280, EBI-739566 | |
BINARY | Q14CN4 | KRT16 P08779 | 3 | EBI-1221280, EBI-356410 | |
BINARY | Q14CN4 | KRT19 P08727 | 3 | EBI-1221280, EBI-742756 | |
BINARY | Q14CN4 | KRT20 P35900 | 3 | EBI-1221280, EBI-742094 | |
BINARY | Q14CN4 | KRT24 Q2M2I5 | 3 | EBI-1221280, EBI-2952736 | |
BINARY | Q14CN4 | KRT25 Q7Z3Z0 | 3 | EBI-1221280, EBI-11980019 | |
BINARY | Q14CN4 | KRT27 Q7Z3Y8 | 3 | EBI-1221280, EBI-3044087 | |
BINARY | Q14CN4 | KRT31 Q15323 | 3 | EBI-1221280, EBI-948001 | |
BINARY | Q14CN4 | KRT32 Q14532 | 3 | EBI-1221280, EBI-1044146 | |
BINARY | Q14CN4 | KRT33B Q14525 | 3 | EBI-1221280, EBI-1049638 | |
BINARY | Q14CN4 | KRT35 Q92764 | 3 | EBI-1221280, EBI-1058674 | |
BINARY | Q14CN4 | KRT38 O76015 | 3 | EBI-1221280, EBI-1047263 | |
BINARY | Q14CN4 | KRT40 Q6A162 | 3 | EBI-1221280, EBI-10171697 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, domain, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-124 | Head | ||||
Sequence: MSRQLTHFPRGERLGFSGCSAVLSGGIGSSSASFRARVKGSASFGSKSLSCLGGSRSLALSAAARRGGGRLGGFVGTAFGSAGLGPKCPSVCPPGGIPQVTVNKSLLAPLNVEMDPEIQRVRAQ | ||||||
Region | 125-160 | Coil 1A | ||||
Sequence: EREQIKALNNKFASFIDKVRFLEQQNQVLETKWNLL | ||||||
Domain | 125-438 | IF rod | ||||
Sequence: EREQIKALNNKFASFIDKVRFLEQQNQVLETKWNLLQQLDLNNCRKNLEPIYEGYISNLQKQLEMLSGDGVRLDSELRNMQDLVEDYKKRYEVEINRRTAAENEFVVLKKDVDAAYMNKVELQAKVDSLTDEIKFFKCLYEGEITQIQSHISDTSIVLSMDNNRDLDLDSIIAEVRAQYEEIALKSKAEAETLYQTKIQELQVTAGQHGDDLKLTKAEISELNRLIQRIRSEIGNVKKQCADLETAIADAEQRGDCALKDARAKLDELEGALHQAKEELARMLREYQELVSLKLALDMEIATYRKLLESEECRM | ||||||
Region | 161-179 | Linker 1 | ||||
Sequence: QQLDLNNCRKNLEPIYEGY | ||||||
Region | 180-271 | Coil 1B | ||||
Sequence: ISNLQKQLEMLSGDGVRLDSELRNMQDLVEDYKKRYEVEINRRTAAENEFVVLKKDVDAAYMNKVELQAKVDSLTDEIKFFKCLYEGEITQI | ||||||
Region | 272-295 | Linker 12 | ||||
Sequence: QSHISDTSIVLSMDNNRDLDLDSI | ||||||
Region | 296-434 | Coil 2 | ||||
Sequence: IAEVRAQYEEIALKSKAEAETLYQTKIQELQVTAGQHGDDLKLTKAEISELNRLIQRIRSEIGNVKKQCADLETAIADAEQRGDCALKDARAKLDELEGALHQAKEELARMLREYQELVSLKLALDMEIATYRKLLESE | ||||||
Region | 435-511 | Tail | ||||
Sequence: ECRMSGEYPNSVSISVISSTNAGAGGAGFSMGFGASSSYSYKTAAADVKTKGSCGSELKDPLAKTSGSSCATKKASR | ||||||
Region | 486-511 | Disordered | ||||
Sequence: GSCGSELKDPLAKTSGSSCATKKASR | ||||||
Compositional bias | 496-511 | Polar residues | ||||
Sequence: LAKTSGSSCATKKASR |
Sequence similarities
Belongs to the intermediate filament family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q14CN4-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length511
- Mass (Da)55,877
- Last updated2008-01-15 v2
- Checksum61E830C382063731
Q14CN4-2
- Name2
- Differences from canonical
- 363-363: Missing
Q14CN4-3
- Name3
- Differences from canonical
- 322-363: Missing
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for alternative sequence, compositional bias.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY033496 EMBL· GenBank· DDBJ | AAK55109.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY033495 EMBL· GenBank· DDBJ | AAK55108.1 EMBL· GenBank· DDBJ | mRNA | ||
AK093060 EMBL· GenBank· DDBJ | BAC04039.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK293645 EMBL· GenBank· DDBJ | BAG57099.1 EMBL· GenBank· DDBJ | mRNA | ||
AC055715 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC113686 EMBL· GenBank· DDBJ | AAI13687.1 EMBL· GenBank· DDBJ | mRNA |