Q14AI6 · RUSD3_MOUSE
- ProteinMitochondrial mRNA pseudouridine synthase Rpusd3
- GeneRpusd3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids344 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Catalyzes uridine to pseudouridine isomerization (pseudouridylation) of specific mitochondrial mRNAs (mt-mRNAs), a post-transcriptional modification necessary for their translation. Acts at position 390 in COXI mt-mRNA and at position 697-699 in mitochondrial COXIII mt-mRNA. As a component of a functional protein-RNA module, consisting of RCC1L, NGRN, RPUSD3, RPUSD4, TRUB2, FASTKD2 and 16S mitochondrial ribosomal RNA (16S mt-rRNA), controls 16S mt-rRNA abundance and may play a role in mitochondrial ribosome biogenesis.
Catalytic activity
- a uridine in mRNA = a pseudouridine in mRNA
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial matrix | |
Cellular Component | ribonucleoprotein granule | |
Molecular Function | pseudouridine synthase activity | |
Molecular Function | RNA binding | |
Biological Process | mRNA processing | |
Biological Process | positive regulation of mitochondrial translation | |
Biological Process | pseudouridine synthesis |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameMitochondrial mRNA pseudouridine synthase Rpusd3
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ14AI6
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes to mitochondrial RNA granules, platforms for post-transcriptional RNA modification and ribosome assembly.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-36 | Mitochondrion | ||||
Sequence: MGALRVLRYVSMIWRPELGSCARQRDAGFGTEARRP | ||||||
Chain | PRO_0000300823 | 37-344 | Mitochondrial mRNA pseudouridine synthase Rpusd3 | |||
Sequence: SQPHRSSKHKDLVEDQPFPGLLRTENLGLEELAHVLRAAVVDQKGPLVTLNKPQGLPVTGRPGELTLLSVLPQLSQALGLEHQELQVVRAPGKEASGLVLLSSCPQTASRLQKFFIHSRRAQRPTATYCAVTDGIPEPSEGTVCMPLKMEQMNDVDLAVPVMSPSRKDIQEGVKRTLSRFHVMATGRGCALVQLQPLTVFPNQLQVHMALQLCPILGDHTYAARVGTVLGQRFLWPAETTKPQRQVLDEALLRHLRLSPSQVAQMPLHLHLHRLLLPGTGSRDPPSELLAPLPPYFSRTLQCLRLSQQ |
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 25-53 | Disordered | ||||
Sequence: RDAGFGTEARRPSQPHRSSKHKDLVEDQP |
Sequence similarities
Belongs to the pseudouridine synthase RluA family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
Q14AI6-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length344
- Mass (Da)38,076
- Last updated2006-08-22 v1
- Checksum3B3C75A2F67CB7D0
Q14AI6-2
- Name2
- Differences from canonical
- 283-344: LDEALLRHLRLSPSQVAQMPLHLHLHRLLLPGTGSRDPPSELLAPLPPYFSRTLQCLRLSQQ → GPLSHMPALCGFGGNCVSQISCTFRLGGSWLGV
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 14 | in Ref. 2; AAH38081 | ||||
Sequence: W → T | ||||||
Alternative sequence | VSP_027871 | 283-344 | in isoform 2 | |||
Sequence: LDEALLRHLRLSPSQVAQMPLHLHLHRLLLPGTGSRDPPSELLAPLPPYFSRTLQCLRLSQQ → GPLSHMPALCGFGGNCVSQISCTFRLGGSWLGV |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK076749 EMBL· GenBank· DDBJ | BAC36463.1 EMBL· GenBank· DDBJ | mRNA | ||
AK133871 EMBL· GenBank· DDBJ | BAE21901.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
BC038081 EMBL· GenBank· DDBJ | AAH38081.1 EMBL· GenBank· DDBJ | mRNA | ||
BC116825 EMBL· GenBank· DDBJ | AAI16826.1 EMBL· GenBank· DDBJ | mRNA | ||
BC116827 EMBL· GenBank· DDBJ | AAI16828.1 EMBL· GenBank· DDBJ | mRNA |