Q149S1 · TEKT4_MOUSE
- ProteinTektin-4
- GeneTekt4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids447 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia and flagellar axoneme. Forms filamentous polymers in the walls of ciliary and flagellar microtubules (PubMed:37295417, PubMed:37865089, PubMed:37989994).
Contributes to normal sperm motility (PubMed:17244819).
Contributes to normal sperm motility (PubMed:17244819).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | axonemal A tubule inner sheath | |
Cellular Component | axonemal microtubule | |
Cellular Component | microtubule cytoskeleton | |
Cellular Component | sperm flagellum | |
Cellular Component | sperm midpiece | |
Cellular Component | sperm principal piece | |
Biological Process | cilium assembly | |
Biological Process | cilium movement involved in cell motility | |
Biological Process | flagellated sperm motility | |
Biological Process | regulation of brood size |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameTektin-4
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ149S1
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Found in the abaxial (convex) surface of outer dense fibers in sperm flagella.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
In a 129S5/SvEvBrd genetic background, males show progressive reduction in fertility with almost complete loss of fertility after 5 months of breeding. Testis weight and histology appear normal. Spermatozoa have significantly reduced forward motility. The sperm flagellum shows defective bending in the midpiece region which impairs waveform propagation and forward propulsion. Sperm ATP levels deplete significantly over time, probably as a result of excess energy consumption from inefficient flagellar beating. The ultrastructure of the flagellum has some subtle abnormalities with an enlarged space between the mitochondrial sheath and the outer dense fibers. In a mixed C57BL/6J;129S5/SvEvBrd genetic background, male fertility is not significantly affected.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 31 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000261163 | 1-447 | Tektin-4 | |||
Sequence: MAQTGVLLTKEPAPQSIDVCELPRKEYEVACNTGAYTSSGLATAGFRTAKYLRDEWFQNSYARYHQAFADRDYSERQRHESGQLVAETGALAQRTQLDSTRKVGERLEDMHCWKSELQREIDELSSETDLMMAQKLRLQRALDATSVPYSIATDNLQCRERRQHPDLVRDYVEVELLKETELIRNIQELLKRTIGQAVDQIRLNREHKESCEMNWSDKVEVYNIDDTCSRYTNESTQVQFYPHSSKFEESASTPETWAKFNHDNLLRAERERLASVNLRKLIDCILRDTAEDLRLQCDAVNSAFSSRCQELDDSLQKLQYHLRKTLTEITDQEHQIAALKQAIKDKEAPLRVAQTRLYQRSHRPNVELCRDNAQFRLLSEVEELNMSLRALKEKLQDAEQALRNLEDSRMSLEKDIAVKTNSLFIDRQKCMTHRNRYPSVLQLAGYQ |
Post-translational modification
Ubiquitinated, leading to its degradation. Deubiquitinated by USP16, promoting its stability.
Keywords
- PTM
Proteomic databases
2D gel databases
PTM databases
Expression
Tissue specificity
Detected in testis, where it is weakly expressed in round spermatids, and strongly expressed in the flagellum of step 16 elongated spermatids (at protein level) (PubMed:17244819).
Expressed in spermatozoa (PubMed:36708031).
In the sperm flagellum, localizes to the principal piece and midpiece (at protein level) (PubMed:16596631, PubMed:17244819).
Specifically expressed in testis; not detected in other tissues tested (PubMed:17244819).
Expressed in spermatozoa (PubMed:36708031).
In the sperm flagellum, localizes to the principal piece and midpiece (at protein level) (PubMed:16596631, PubMed:17244819).
Specifically expressed in testis; not detected in other tissues tested (PubMed:17244819).
Developmental stage
Detected in testis from postnatal day 16 onwards, reaching maximal levels by postnatal day 18.
Gene expression databases
Structure
Family & Domains
Features
Showing features for coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 322-348 | |||||
Sequence: LRKTLTEITDQEHQIAALKQAIKDKEA | ||||||
Coiled coil | 375-423 | |||||
Sequence: FRLLSEVEELNMSLRALKEKLQDAEQALRNLEDSRMSLEKDIAVKTNSL |
Sequence similarities
Belongs to the tektin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length447
- Mass (Da)52,045
- Last updated2018-10-10 v2
- ChecksumCBE31B4B53A8CEF7
Computationally mapped potential isoform sequences
There are 6 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0AAA9WW16 | A0AAA9WW16_MOUSE | Tekt4 | 207 | ||
A0AAA9WW21 | A0AAA9WW21_MOUSE | Tekt4 | 415 | ||
A0AAA9WW41 | A0AAA9WW41_MOUSE | Tekt4 | 62 | ||
A0AAA9WUV8 | A0AAA9WUV8_MOUSE | Tekt4 | 225 | ||
A0AAA9WUT0 | A0AAA9WUT0_MOUSE | Tekt4 | 235 | ||
A0A3Q4EH78 | A0A3Q4EH78_MOUSE | Tekt4 | 442 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 262 | in Ref. 4; AAI17511/AAI17527 | ||||
Sequence: H → Q | ||||||
Sequence conflict | 434 | in Ref. 2; BAB24268 | ||||
Sequence: R → S |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY485267 EMBL· GenBank· DDBJ | AAS55789.1 EMBL· GenBank· DDBJ | mRNA | ||
AK005842 EMBL· GenBank· DDBJ | BAB24268.1 EMBL· GenBank· DDBJ | mRNA | ||
AC131323 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC117510 EMBL· GenBank· DDBJ | AAI17511.1 EMBL· GenBank· DDBJ | mRNA | ||
BC117526 EMBL· GenBank· DDBJ | AAI17527.1 EMBL· GenBank· DDBJ | mRNA |