Q14919 · NC2A_HUMAN
- ProteinDr1-associated corepressor
- GeneDRAP1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids205 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | negative cofactor 2 complex | |
Cellular Component | nucleus | |
Cellular Component | RNA polymerase II transcription regulator complex | |
Molecular Function | core promoter sequence-specific DNA binding | |
Molecular Function | identical protein binding | |
Molecular Function | protein heterodimerization activity | |
Molecular Function | RNA polymerase II general transcription initiation factor activity | |
Molecular Function | RNA polymerase II general transcription initiation factor binding | |
Molecular Function | TBP-class protein binding | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDr1-associated corepressor
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ14919
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 222 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for initiator methionine, chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Initiator methionine | 1 | UniProt | Removed | ||||
Sequence: M | |||||||
Chain | PRO_0000080001 | 2-205 | UniProt | Dr1-associated corepressor | |||
Sequence: PSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEEDEEDYDS | |||||||
Modified residue (large scale data) | 89 | PRIDE | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Phosphorylation reduces DNA binding, but has no effect on heterodimerization and TBP binding.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Ubiquitous. Highly expressed in adult testis, heart, skeletal muscle, pancreas and brain, and in fetal brain, liver and kidney.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Heterodimer with DR1. Binds BTAF1.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q14919 | DR1 Q01658 | 48 | EBI-712941, EBI-750300 | |
BINARY | Q14919 | DRAP1 Q14919 | 3 | EBI-712941, EBI-712941 | |
BINARY | Q14919 | GTF2B Q00403 | 6 | EBI-712941, EBI-389564 | |
BINARY | Q14919 | LMO2 P25791 | 3 | EBI-712941, EBI-739696 | |
BINARY | Q14919 | LMO2 P25791-3 | 3 | EBI-712941, EBI-11959475 | |
BINARY | Q14919 | LNX1 Q8TBB1 | 3 | EBI-712941, EBI-739832 | |
BINARY | Q14919 | MCRS1 Q96EZ8 | 3 | EBI-712941, EBI-348259 | |
BINARY | Q14919 | MORF4L1 Q9UBU8-2 | 3 | EBI-712941, EBI-10288852 | |
BINARY | Q14919 | NCK2 O43639 | 3 | EBI-712941, EBI-713635 | |
BINARY | Q14919 | NFYB P25208 | 4 | EBI-712941, EBI-389728 | |
BINARY | Q14919 | PICK1 Q9NRD5 | 3 | EBI-712941, EBI-79165 | |
BINARY | Q14919 | PIK3R3 Q92569 | 4 | EBI-712941, EBI-79893 | |
BINARY | Q14919 | POLE3 Q9NRF9 | 8 | EBI-712941, EBI-744901 | |
BINARY | Q14919 | RPL9P9 P32969 | 3 | EBI-712941, EBI-358122 | |
BINARY | Q14919 | SDCBP O00560 | 5 | EBI-712941, EBI-727004 | |
BINARY | Q14919 | TAF9 Q16594 | 9 | EBI-712941, EBI-712521 | |
BINARY | Q14919 | TAF9B Q9HBM6 | 7 | EBI-712941, EBI-751601 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 14-77 | Histone-fold | ||||
Sequence: PARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELE | ||||||
Region | 91-205 | Disordered | ||||
Sequence: PDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEEDEEDYDS | ||||||
Compositional bias | 96-112 | Basic and acidic residues | ||||
Sequence: DGEDNHMDGDKGARRGR | ||||||
Compositional bias | 124-138 | Basic and acidic residues | ||||
Sequence: MGTKSKDKKLSGTDS | ||||||
Compositional bias | 139-153 | Acidic residues | ||||
Sequence: EQEDESEDTDTDGEE | ||||||
Compositional bias | 154-170 | Polar residues | ||||
Sequence: ETSQPPPQASHPSAHFQ | ||||||
Compositional bias | 177-193 | Pro residues | ||||
Sequence: LPFASTLPLPPAPPGPS |
Sequence similarities
Belongs to the NC2 alpha/DRAP1 family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q14919-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length205
- Mass (Da)22,350
- Last updated2007-01-23 v3
- Checksum6154C43C6B8DC877
Q14919-2
- Name2
- Differences from canonical
- 111-111: G → WTVPSQR
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Features
Showing features for sequence conflict, compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 2-15 | in Ref. 2; AA sequence | ||||
Sequence: PSKKKKYNARFPPA → EF | ||||||
Compositional bias | 96-112 | Basic and acidic residues | ||||
Sequence: DGEDNHMDGDKGARRGR | ||||||
Alternative sequence | VSP_012215 | 111 | in isoform 2 | |||
Sequence: G → WTVPSQR | ||||||
Compositional bias | 124-138 | Basic and acidic residues | ||||
Sequence: MGTKSKDKKLSGTDS | ||||||
Compositional bias | 139-153 | Acidic residues | ||||
Sequence: EQEDESEDTDTDGEE | ||||||
Compositional bias | 154-170 | Polar residues | ||||
Sequence: ETSQPPPQASHPSAHFQ | ||||||
Compositional bias | 177-193 | Pro residues | ||||
Sequence: LPFASTLPLPPAPPGPS |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X96506 EMBL· GenBank· DDBJ | CAA65358.1 EMBL· GenBank· DDBJ | mRNA | ||
U41843 EMBL· GenBank· DDBJ | AAB02192.1 EMBL· GenBank· DDBJ | mRNA | ||
BC010025 EMBL· GenBank· DDBJ | AAH10025.1 EMBL· GenBank· DDBJ | mRNA |