Q14532 · K1H2_HUMAN
- ProteinKeratin, type I cuticular Ha2
- GeneKRT32
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids448 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
Miscellaneous
There are two types of hair/microfibrillar keratin, I (acidic) and II (neutral to basic).
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 345 | Stutter | ||||
Sequence: A |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoskeleton | |
Cellular Component | cytosol | |
Cellular Component | extracellular exosome | |
Cellular Component | intermediate filament | |
Molecular Function | structural molecule activity | |
Biological Process | epidermis development | |
Biological Process | epithelial cell differentiation | |
Biological Process | intermediate filament organization |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameKeratin, type I cuticular Ha2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ14532
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_056011 | 72 | in dbSNP:rs3744786 | |||
Sequence: Q → R | ||||||
Natural variant | VAR_069391 | 89 | in dbSNP:rs565998951 | |||
Sequence: E → K | ||||||
Natural variant | VAR_060237 | 151 | in dbSNP:rs1111168 | |||
Sequence: E → D | ||||||
Natural variant | VAR_056012 | 171 | in dbSNP:rs2071560 | |||
Sequence: I → T | ||||||
Natural variant | VAR_056013 | 222 | in dbSNP:rs2071561 | |||
Sequence: S → Y | ||||||
Natural variant | VAR_060238 | 280 | in dbSNP:rs72830046 | |||
Sequence: R → H | ||||||
Natural variant | VAR_056014 | 339 | in dbSNP:rs16966929 | |||
Sequence: T → M | ||||||
Natural variant | VAR_056015 | 395 | in dbSNP:rs2071563 | |||
Sequence: T → M | ||||||
Natural variant | VAR_060239 | 402 | in dbSNP:rs2604955 | |||
Sequence: N → S | ||||||
Natural variant | VAR_060240 | 427 | in dbSNP:rs2604953 | |||
Sequence: P → T | ||||||
Natural variant | VAR_056016 | 428 | in dbSNP:rs9893787 | |||
Sequence: R → C |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 625 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000063686 | 1-448 | Keratin, type I cuticular Ha2 | |||
Sequence: MTSSCCVTNNLQASLKSCPRPASVCSSGVNCRPELCLGYVCQPMACLPSVCLPTTFRPASCLSKTYLSSSCQAASGISGSMGPGSWYSEGAFNGNEKETMQFLNDRLASYLTRVRQLEQENAELESRIQEASHSQVLTMTPDYQSHFRTIEELQQKILCTKAENARMVVNIDNAKLAADDFRAKYEAELAMRQLVEADINGLRRILDDLTLCKADLEAQVESLKEELMCLKKNHEEEVGSLRCQLGDRLNIEVDAAPPVDLTRVLEEMRCQYEAMVEANRRDVEEWFNMQMEELNQQVATSSEQLQNYQSDIIDLRRTVNTLEIELQAQHSLRDSLENTLTESEARYSSQLAQMQCMITNVEAQLAEIRADLERQNQEYQVLLDVRARLEGEINTYRSLLENEDCKLPCNPCSTPSCTTCVPSPCVPRTVCVPRTVGMPCSPCPQGRY |
Proteomic databases
PTM databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q14532 | GATAD2A Q86YP4 | 3 | EBI-1044146, EBI-726224 | |
BINARY | Q14532 | KIFC3 Q9BVG8-5 | 3 | EBI-1044146, EBI-14069005 | |
BINARY | Q14532 | KRT72 Q14CN4 | 3 | EBI-1044146, EBI-1221280 | |
BINARY | Q14532 | KRT80 Q6KB66-2 | 4 | EBI-1044146, EBI-11999246 | |
BINARY | Q14532 | KRT86 O43790 | 3 | EBI-1044146, EBI-9996498 | |
BINARY | Q14532 | MGC50722 Q8IVT4 | 3 | EBI-1044146, EBI-14086479 | |
BINARY | Q14532 | NEDD9 Q14511-2 | 3 | EBI-1044146, EBI-11746523 | |
XENO | Q14532 | rep PRO_0000449633 P0DTD1 | 3 | EBI-1044146, EBI-25492395 | |
BINARY | Q14532 | TCHP Q9BT92 | 3 | EBI-1044146, EBI-740781 | |
BINARY | Q14532 | UBASH3A P57075-2 | 3 | EBI-1044146, EBI-7353612 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-96 | Head | ||||
Sequence: MTSSCCVTNNLQASLKSCPRPASVCSSGVNCRPELCLGYVCQPMACLPSVCLPTTFRPASCLSKTYLSSSCQAASGISGSMGPGSWYSEGAFNGNE | ||||||
Domain | 96-407 | IF rod | ||||
Sequence: EKETMQFLNDRLASYLTRVRQLEQENAELESRIQEASHSQVLTMTPDYQSHFRTIEELQQKILCTKAENARMVVNIDNAKLAADDFRAKYEAELAMRQLVEADINGLRRILDDLTLCKADLEAQVESLKEELMCLKKNHEEEVGSLRCQLGDRLNIEVDAAPPVDLTRVLEEMRCQYEAMVEANRRDVEEWFNMQMEELNQQVATSSEQLQNYQSDIIDLRRTVNTLEIELQAQHSLRDSLENTLTESEARYSSQLAQMQCMITNVEAQLAEIRADLERQNQEYQVLLDVRARLEGEINTYRSLLENEDCKL | ||||||
Region | 97-131 | Coil 1A | ||||
Sequence: KETMQFLNDRLASYLTRVRQLEQENAELESRIQEA | ||||||
Region | 132-142 | Linker 1 | ||||
Sequence: SHSQVLTMTPD | ||||||
Region | 143-243 | Coil 1B | ||||
Sequence: YQSHFRTIEELQQKILCTKAENARMVVNIDNAKLAADDFRAKYEAELAMRQLVEADINGLRRILDDLTLCKADLEAQVESLKEELMCLKKNHEEEVGSLRC | ||||||
Region | 244-259 | Linker 12 | ||||
Sequence: QLGDRLNIEVDAAPPV | ||||||
Region | 260-403 | Coil 2 | ||||
Sequence: DLTRVLEEMRCQYEAMVEANRRDVEEWFNMQMEELNQQVATSSEQLQNYQSDIIDLRRTVNTLEIELQAQHSLRDSLENTLTESEARYSSQLAQMQCMITNVEAQLAEIRADLERQNQEYQVLLDVRARLEGEINTYRSLLENE | ||||||
Region | 404-448 | Tail | ||||
Sequence: DCKLPCNPCSTPSCTTCVPSPCVPRTVCVPRTVGMPCSPCPQGRY |
Sequence similarities
Belongs to the intermediate filament family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length448
- Mass (Da)50,343
- Last updated2010-11-02 v3
- ChecksumF223A4F828B7EACB
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 152 | in Ref. 1; CAA62284 and 4; CAA57179 | ||||
Sequence: E → Q | ||||||
Sequence conflict | 371 | in Ref. 1; CAA62284 and 4; CAA57179 | ||||
Sequence: D → E |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X90761 EMBL· GenBank· DDBJ | CAA62284.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC019349 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
X81419 EMBL· GenBank· DDBJ | CAA57179.1 EMBL· GenBank· DDBJ | mRNA | Different initiation |